TeeChip ‘Jos124; Loja de impressões personalizadas ‘Josep 124; camisetas, canecas, máscaras faciais, cartazes’

  • 2022-01-04Data de coleta
  • 2022-02-15Atualizada
TeeChip ‘Jos124; Loja de impressões personalizadas ‘Josep 124; camisetas, canecas, máscaras faciais, cartazes’
  • Endereço do website:teechip.com
  • IP do servidor:35.82.146.183
  • Descrição do Site:Loja de camisas personalizadas e vestuário online com TeeChip. Comprar caixas telefónicas, fronhas & cama, Mugs, pôsteres, máscaras faciais ​​Baa124; Loja Personalizada de Artistas

nome do domínio:teechip.comAvaliação

cerca de 5000~500000

nome do domínio:teechip.comfluxo

344

nome do domínio:teechip.comBom ou mal

Tremendo. Muitas vezes na adversidade feroz

local na rede Internet:TeeChip ‘Jos124; Loja de impressões personalizadas ‘Josep 124; camisetas, canecas, máscaras faciais, cartazes’Pesos

4

local na rede Internet:TeeChip ‘Jos124; Loja de impressões personalizadas ‘Josep 124; camisetas, canecas, máscaras faciais, cartazes’IP

35.82.146.183

local na rede Internet:TeeChip ‘Jos124; Loja de impressões personalizadas ‘Josep 124; camisetas, canecas, máscaras faciais, cartazes’contente

(function(i,s,o,g,r,a,m){i['GoogleAnalyticsObject']=r;i[r]=i[r]||function(){(i[r].q=i[r].q||[]).push(arguments)},i[r].l=1*newDate();a=s.createElement(o);varn=s.querySelector('[nonce]');m=s.getElementsByTName(o)[0];a.async=1;a.setAttribute('nonce',n.nonce||n.getAttribute('nonce'));a.src=g;m.parentNode.insertBefore(a,m)})(window,document,'script','/analytics.js','ga');(function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':newDate().getTime(),event:'gtm.js'});varf=d.getElementsByTName(s)[0],j=d.createElement(s),dl=l!='dataLayer'?'&l='+l:'';j.async=true;j.src='///gtm.js?id='+i+dl+'';varn=d.querySelector('[nonce]');n&&j.setAttribute('nonce',n.nonce||n.getAttribute('nonce'));f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-TKKBL27');ga('create','UA-8-1','auto','root');ga('root.require','ecommerce');ga('root.set','exp','MKwnRg3LSiqW-BPqtjybOw.0!n4JstVQfTw-97O7BhX3UNw.0!sAcL6hFYTJuYW0N0mEVKKw.0!me3UsgfrSpK3LpBM4302bQ.0!tmvkOdzaSaOc5i2XK_xaww.1!q1TwrLfxRpWRFtbWKwwPqQ.0!dWlQRwJHRl-lNLPHHbP9dA.0!kauVnFdKTvKUDe3z_Zg1NQ.0!mrcLfwYFReKJi9zkIN1zow.1!IH5eyBXBQPOa173Mp9gPkg.1!w-vtX76ATTydImJMcRjbqg.0!B4lV5y5tTei88K8NxtGgnA.1!M7_OYYtkSiCG2nT7YpDO3g.0!xAjMUYPSQ2y7vlaz1sY52Q.1!MLGL5VNjT6eRACkC2vSMew.1!w5UMSs44SB2cq4OcBhWaYA.1!bcPKHkehSpaBN--Nm_UcfQ.1!h-YTQaORQsiYpn5eIgiy1A.1!oRO953CrQX-LyAIfDX3kzQ.0!vsNzqRANQ3WrnNB4LnwYeQ.1!SbTIZZWASnaUvFTIUKUzCw.1!K4BaFl1dR8erMD7eJtnk9w.1!17UnOC3PSH2R4XB49ABBBA.0!t5PuTb7eRT2b5Kt6ggcq-A.1!ArL0ISfIQ3yUolNB6Tzw.1!XJPg2T6_TamksbFfGRmXjg.1!Rob9xpHARCWORVzUd1Nb8A.1!baZf9m4aQmyxD00C-lI-3A.1!‌bHV-xN3mTfKYtD68r7LmYQ.1!TH1wCuXyQFGzznpnuswddQ.0!SPafMCQEQkO5K0oArOH-gA.1!vYoel2YJQCuDGzRjImjXlw.1!RnYzAjTBTxSialYRf064hQ.1!C7vESJXNT52u5G10RZvW9g.1!pNVdYuckRIG30IQc3q6egQ.1!MRxQxDbPRIKPsTebgVkblQ.1!Vtha__EUR5CwLAMKvHgw.1');TeeChip|Customprintsstore|T-shirts,mugs,facemasks,postersbody.retail-app{font-size:16px;}:root{}window.__INITIAL_STATE__={"localeData":{"locale":"en-US","geo":{"range":[16,07],"country":"US","region":"","eu":"0","timezone":"America/Chico","city":"","ll":[37.751,-97.822],"metro":0,"area":1000},"messes":{"":"$25-$160","-20x24-":"\b20x24'","-24x20-":"\b24x20'","-24x36-":"\b24x36'","-36x24-":"\b36x24'","-l1":":l1","10-week-delivery-schedule":"10WeekDeliverySchedule","10.5x10.5-wooden-print":"10.5x10.5\"-WoodenPrint","10.5x36-wooden-print":"10.5x36\"-WoodenPrint","6":"6","104x88-comforters-king-size":"104x88”Comforters-KingSize","10pcs-set-silicone-food-store-containers":"10PCSSetSiliconeFoodStoreContainers","10x8-":"10x8'","10x8-easel-back-gallery-wrapped-canvas":"10x8Easel-BackGalleryWrappedCanvas","11-x-17-posters":"11x17\"Posters","11x14-":"11x14'","11x14-black-floating-framed-canvas-prints":"11x14BlackFloatingFramedCanvasPrints","11x14-gallery-wrapped-canvas-prints":"11x14GalleryWrappedCanvasPrints","11x17-poster":"11x17Poster","11x17poster":"11x17Poster","11x17posters":"11x17\"Posters","12-5x8-5-black-zipper":"12-5x8-5”BlackZipper","12x16-":"12x16'","12x16-black-hanging-canvas":"12x16BlackHangingCanvas","12x18-metal-print":"12x18MetalPrint","12x18metalprint":"12x18MetalPrint","12x9-area-rug":"12x9-AreaRug","14-29":"14:29","14x11-":"14x11'","14x11-gallery-wrapped-canvas-prints":"14x11GalleryWrappedCanvasPrints","14x11-white-floating-framed-canvas-prints":"14x11WhiteFloatingFramedCanvasPrints","14x14-wooden-print":"14x14\"-WoodenPrint","14x24-wooden-print":"14x24\"-WoodenPrint","16-blades-feeler-gauge-metstainless-steel-gap-filler-gauge-measurement-tool-for-engine-adjustment":"16BladesFeelerGaugeMetStainlessSteelGapFillerGaugeMeasurementToolforEngineAdjustment","16-x-24-posters":"16x24\"Posters","16oz":"16oz","16oz-pint-glass":"16ozPintGlass","16x16-":"16x16'","16x16-all-over-totes":"16x16”AlloverTotes","16x16-gallery-wrapped-canvas-prints":"16x16GalleryWrappedCanvasPrints","16x20-":"16x20'","16x20-black-hanging-canvas":"16x20BlackHangingCanvas","16x20-gallery-wrapped-canvas-prints":"16x20GalleryWrappedCanvasPrints","16x24-":"16x24'","16x24-gallery-wrapped-canvas-prints":"16x24GalleryWrappedCanvasPrints","16x24-poster":"16x24Poster","16x24poster":"16x24Poster","16x24posters":"16x24\"Posters","17-x-11-posters":"17x11'Posters","17.5x24-wooden-print":"17.5x24\"-WoodenPrint","17x11-poster":"17x11Poster","17x11poster":"17x11Poster","17x11posters":"17x11\"Posters","18v-4000rpm-min-cordless-electric-reciprocating-saw-variable-speed-metal-wood-cutting-tool-electric-saw-for-makita-18v-battery":"18V4000rpm/minCordlessElectricReciprocatingSawVariableSpeedMetalWoodCuttingToolElectricSawforMakita18VBattery","18x12-lawn-sign":"18x12LawnSign","18x12-yard-sign":"18x12YardSign","18x14-placemats":"18x14”Placemats","18x30-area-rug":"18x30-AreaRug","1pc-wooden-bowl-japanese-style-wood":"1PcWoodenBowlJapaneseStyleWood","2-layer-face-mask":"2LayerFaceMask","2-layer-face-mask-3-pack":"2LayerFaceMask-3Pack","2-layer-face-mask-5-pack":"2LayerFaceMask-5Pack","2-layer-face-mask-single":"2LayerFaceMask-Single","2-layer-kids-face-mask":"2LayerKidsFaceMask","2-layer-kids-face-mask-3-pack":"2LayerKidsFaceMask-3Pack","2-layer-kids-face-mask-5-pack":"2LayerKidsFaceMask-5Pack","2-layer-kids-face-mask-single":"2LayerKidsFaceMask-Single","2019-high-quality-tie-dyed-maple-leaf-socks-long-fashion-weed-socks-men-skateboard-hiphop-socks-couple-socks-1-pairs":"2019High-qualityTie-dyedMapleLeafSocksLongFashionWeedSocksMenSkateboardHiphopSocksCoupleSocks1Pairs","2020-summer-casual-shoes-new-men-sandals-gladiator-sandals-open-toe-platform-outdoor-beach-sandal-rome-footwear-black":"2020SummerCasualShoesNewMenSandalsGladiatorSandalsOpenToePlatformOutdoorBeachSandalRomeFootwearBlack","2021-nordic-warm-family-valentine-s-day-wedding-gift-modern-tv-cabinet-happy-family-living-room-decoration":"2021NordicWarmFamilyValentine'sDayWeddingGiftModernTvCabinetHappyFamilyLivingRoomDecoration","2021-sexy-one-piece-swimsuit-push-up-swimwear-women-ruffle-adjustable-shoulder-swimsuit-bodysuit-bathing-suit-swim-wear":"2021SexyOnePieceSwimsuitPushUpSwimwearWomenRuffleAdjustableShoulderSwimsuitBodysuitBathingSuitSwimWear","2021-sexy-one-piece-swimsuit-push-up-women-ruffle-monokini-adjustable-shoulder-swimsuit-bodysuit-bathing-suit-swim-wear":"2021SexyOnePieceSwimsuitPushUpWomenRuffleMonokiniAdjustableShoulderSwimsuitBodysuitBathingSuitSwimWear","2021-upgrade-stereo-headset-bluetooth":"2021UpgradeStereoHeadsetBluetooth","20oz":"20oz","20oz-cone-glitter-tumbler":"20ozConeGlitterTumbler","20oz-glitter-tumbler":"20ozGlitterTumbler","20oz-tumbler":"20ozTumbler","20x16-":"20x16'","20x16-gallery-wrapped-canvas-prints":"20x16GalleryWrappedCanvasPrints","20x30-":"20x30'","20x30-gallery-wrapped-canvas-prints":"20x30GalleryWrappedCanvasPrints","24-x-16-posters":"24x16'Posters","24-x-36-posters":"24x36\"Posters","24x13-rope-handle":"24x13”RopeHandle","24x14-wooden-print":"24x14\"-WoodenPrint","24x16-":"24x16'","24x16-poster":"24x16Poster","24x16poster":"24x16Poster","24x17.5-wooden-print":"24x17.5\"-WoodenPrint","24x18-":"24x18\"","24x18-yard-sign":"24x18YardSign","24x24-wooden-print":"24x24\"-WoodenPrint","24x36-poster":"24x36Poster","24x36-wooden-print":"24x36\"-WoodenPrint","24x36poster":"24x36Poster","24x36posters":"24x36\"Posters","250-piece-puzzle-vertical-":"250PiecePuzzle(vertical)","26x36-indoor-hemmed-no-grommets":"26x36”IndoorHemmed-Nogrommets","27x30-apron":"27x30”Apron","2x3-area-rug":"2x3-AreaRug","3-layer-face-mask":"3LayerFaceMask","3-layer-face-mask-3-pack":"3LayerFaceMask-3Pack","3-layer-kids-face-mask":"3LayerKidsFaceMask","3-layer-kids-face-mask-3-pack":"3LayerKidsFaceMask-3Pack","3-layer-kids-face-mask-single":"3LayerKidsFaceMask-Single","30oz":"30oz","30oz-cone-glitter-tumbler":"30ozConeGlitterTumbler","30oz-glitter-tumbler":"30ozGlitterTumbler","30oz-tumbler":"30ozTumbler","30x18-area-rug":"30x18-AreaRug","30x20-":"30x20'","30x20-gallery-wrapped-canvas-prints":"30x20GalleryWrappedCanvasPrints","35-53cm-beautiful-colorful-flower-plush-pillow-toy-soft-cartoon-plant-stuffed-doll-chair-cushion-sofa-kids-lovers-gifts":"35-53cmBeautifulColorfulFlowerPlushPillowToySoftCartoonPlantStuffedDollChairCushionSofaKidsLoversGifts","36-x-24-posters":"36x24\"Posters","36x10.5-wooden-print":"36x10.5\"-WoodenPrint","36x24-poster":"36x24Poster","36x24-wooden-print":"36x24\"-WoodenPrint","36x24poster":"36x24Poster","3d-diy-electric-craft-ferris-wheel-puzzle-wooden-model-building-kits-science-educational-toys-for-children-kids":"3DDIYElectricCraftFerrisWheelPuzzleWoodenModelBuildingKitsScienceEducationalToysForChildrenKids","3d-diy-electric-craft-ferris-wheel-puzzle-wooden-model-engineering-kits-science-educational-toys-for-children-kids":"3DDIYElectricCraftFerrisWheelPuzzleWoodenModelEngineeringKitsScienceEducationalToysForChildrenKids","3x2-area-rug":"3x2-AreaRug","3x3x3-speed-cube-5.6-cm-professional-mic":"3x3x3SpeedCube5.6cmProfessionalMic","4-week-delivery-schedule":"4WeekDeliverySchedule","4x6-area-rug":"4x6-AreaRug","5-round-area-rug":"5Round-AreaRug","5-week-delivery-schedule":"5WeekDeliverySchedule","50x60-woven-blanket":"50x60-WovenBlanket","50x84-blackout-window-curtains":"50x84”BlackoutWindowCurtains","50x84-sheer-window-curtains":"50x84”SheerWindowCurtains","51x60-indoor-hemmed-no-grommets":"51x60”IndoorHemmed-Nogrommets","5cba5520fe3f861e":"5cba5520fe3f861e","5d-diy-diamond-painting-keychain-child-cartoons-key-chains":"5DDIYDiamondPaintingKeychainChildCartoonsKeyChains","5mp-hd-ip-camera-1080p-outdoor-security-ptz-wifi-camera-auto-tracking-home-cctv-h265-network-two-way-audio-onvif":"5MPHDIPCamera1080POutdoorSecurityPTZWiFiCameraAutoTrackingHomeCCTVH265NetworkTwoWayAudioOnvif","5mp-ptz-ip-camera-wifi-outdoor-ai-audio-1080p-wireless-security-cctv-camera-p2p-rtsp-4x-digital-zoom-wifi-camera":"5MPPTZIPCameraWifiOutdoorAIAudio1080PWirelessSecurityCCTVCameraP2PRTSP4XDigitalZoomWifiCamera","6-inch-stainless-high-carbon-manganese-steel-boning-knife-handmade-kitchen-knives-fishing-knife-meat-cle-cutter-tool":"6inchStainlessHighCarbonManganeseSteelBoningKnifeHandmadeKitchenKnivesFishingKnifeMeatCleCutterTool","6-week-delivery-schedule":"6WeekDeliverySchedule","60-x-50-hooded-blanket":"60\"x50\"HoodedBlanket","60x80-fleece-blankets":"60x80”FleeceBlankets","60x80-fleece-blankets-coral-velveteen":"60x80”FleeceBlankets-Coral/Velveteen","60x80-fleece-blankets-sherpa":"60x80”FleeceBlankets-Sherpa","60x80-woven-blanket":"60x80-WovenBlanket","812":"812","68x80-indoor-hemmed-no-grommets":"68x80”IndoorHemmed-Nogrommets","6x4-area-rug":"6x4-AreaRug","70-x-60-hooded-blanket":"70\"x60\"HoodedBlanket","714pcs-replacement-toothbrush-heads-7-styles-soft-bristle-for-oral-b-3d-excel-electric-tooth-headsnozzle":"714pcsReplacementToothbrushHeads7StylesSoftBristleforOralB3DExcelElectricToothHeadsNozzle","8-5x6-black-zipper":"8-5x6”BlackZipper","8.5x6-black-zipper":"8.5x6”BlackZipper","80-x-60-hooded-blanket":"80\"x60\"HoodedBlanket","8x10-":"8x10'","8x10-easel-back-gallery-wrapped-canvas":"8x10Easel-BackGalleryWrappedCanvas","9x12-area-rug":"9x12-AreaRug","NaN-week-delivery-schedule":"NaNWeekDeliverySchedule","TITLE:FrequentlyBoughtTogether":"FrequentlyBoughtTogether","TITLE:FrequentlyBoughtTogetherasd":"FrequentlyBoughtTogetherasd","accesorypuches":"AccesoryPuches","accessories":"Accessories","accessories-phonecase":"accessories.phonecase","accessories.bs":"accessories.bs","accessories.bs.accesory-puches":"accessories.bs.accesory-puches","accessories.bs.tote":"accessories.bs.tote","accessories.bs.tote.16x16-all-over-totes":"accessories.bs.tote.16x16-all-over-totes","accessories.mousepads":"accessories.mousepads","accessories.mousepads.mousepad":"accessories.mousepads.mousepad","accessories.neck-gaiter":"accessories.neck-gaiter","accessories.phonecases":"PhoneCases","accessories.phonecases.case":"accessories.phonecases.case","accessories.stickers":"accessories.stickers","accessories.stickers.bumper-sticker":"accessories.stickers.bumper-sticker","accessories.stickers.stickers":"accessories.stickers.stickers","accessoriesbsaccessorypouches":"accessories.bs.accessory-pouches","accessoriesbsweekendertote":"accessories.bs.weekender-tote","accessory-pouch-large":"AccessoryPouch-Large","accessory-pouch-standard":"AccessoryPouch-Standard","accessory-pouches":"AccessoryPouches","accessorypouch125x85":"AccessoryPouch12.5x8.5","accessorypouch85x6":"AccessoryPouch8.5x6","accessorypouchlarge":"AccessoryPouch-Large","accessorypouchstandard":"AccessoryPouch-Standard","add":"Add","add-a-comment":"Addacomment","add-matching-items.add":"Add","add-matching-items.title":"AddMatchingItems","add-matching-items.title-variant-related":"AddRelatedItems","add-more-items":"AddMoreItems","add-photos":"Addaphoto(s)","address.address":"Address","address.address2":"Apt,suite","address.city":"City","address.company":"Company","address.country":"Country","address.shipping-address":"Shippingaddress","address.state":"State","address.zip":"Zip","adjustable-plastic-drawer-divider-diy-store-shelves-ho":"AdjustablePlasticDrawerDividerDIYStoreShelvesHo","afghanistan":"Afghanistan","albania":"Albania","algeria":"Algeria","all":"All","all-over-dress":"All-overDress","all-over-print-dresses":"AllOverPrintDresses","all-over-print-shirts":"AllOverPrintShirts","all-over-print-tanks":"AllOverPrintTanks","all-over-printed-tank":"All-Over-PrintedTank","all-over-printed-tee":"All-OverPrintedTee","all-over-t-shirt":"All-overT-Shirt","all-over-tote":"All-overTote","all-over-unisex-shirts":"AllOverUnisexShirts","all-over-unisex-tank":"All-overUnisexTank","all-over-unisex-tanks":"AllOverUnisexTanks","allove-hd-transparent-lace-front-human-hair-wigs-for-women-30-inch-bone-straight-la-wig-13x4-13x6-hd-lace-frontal-wig":"AlloveHDTransparentLaceFrontHumanHairWigsForWomen30InchBoneStraightLaWig13x413x6HDLaceFrontalWig","alloverdress":"All-overDress","alloverprintedtank":"All-Over-PrintedTank","alloverprintedtee":"All-Over-PrintedTee","allovertote":"All-overTote","allovertshirt":"All-overT-Shirt","alloverunisextank":"All-overUnisexTank","almost-done":"Almostdone","aluminum-alloy-bicycle-rear-derailleur-replacement-mountain-bike-7-speed-cycling-shifting-parts-mtb-bicycle-accessories":"AluminumAlloyBicycleRearDerailleurReplacementMountainBike7SpeedCyclingShiftingPartsMTBBicycleAccessories","american-apparel-ladies-tee":"PremiumFitLadiesTee","american-apparel-tee":"PremiumFitMensTee","american-samoa":"AmericanSamoa","andorra":"Andorra","angola":"Angola","anguilla":"Anguilla","ansjs-mountain-bike-pedals-platform-bicycle-flat-alloy-pedals-sealed-bearings-pedals-non-slip-alloy-flat-pedals":"ANSJSMountainBikePedalsPlatformBicycleFlatAlloyPedalsSealedBearingsPedalsNon-SlipAlloyFlatPedals","antarctica":"Antarctica","anti-dirty-sanitary-toilet-seat-cover-lid-flipper-handle":"Anti-DirtySanitaryToiletSeatCoverLidFlipperHandle","antigua-and-barbuda":"AntiguaandBarbuda","aop-t-shirt-l":"AOPT-ShirtL","aop-t-shirt-large":"AOPT-ShirtLarge","aop-t-shirt-m":"AOPT-ShirtM","aop-t-shirt-medium":"AOPT-ShirtMedium","aop-t-shirt-s":"AOPT-ShirtS","aop-t-shirt-x-large":"AOPT-ShirtXLarge","aos-shirts":"AOSshirts","apparel":"Apparel","apron":"Apron","aprons":"Aprons","argentina":"Argentina","armenia":"Armenia","aruba":"Aruba","ascension-isles":"AscensionIsles","ash":"Ash","asphalt":"Asphalt","athletic-heather":"AthleticHeather","athleticheather":"AthleticHeather","australia":"Australia","austria":"Austria","azerbaijan":"Azerbaijan","baby-blue":"BabyBlue","baby-onesie":"BabyOnesie","baby-plush-animals-stuffed-dinosaur":"BabyPlushAnimalsStuffedDinosaur","baby-shower-bath-tub-non-slip-bathtub-newborn-safety-bath-support-cushion-steering-wheel-design-improve-children-":"BabyShowerBathTubNon-SlipBathtubNewbornSafetyBathSupportCushionSteeringWheelDesignImproveChildren'","babyblue":"BabyBlue","back":"back","back-masse-stretcher":"BackMasseStretcher","backpack":"Backpack","b":"B","bs":"Bs","bahamas":"Bahamas","bahrain":"Bahrain","bangladesh":"Bangladesh","barbados":"Barbados","baseball-tee":"BaseballTee","baseballtee":"BaseballTee","baseus-100w-usb-c-to-usb-type-c-cable-usbc-pd-fast-charger-cord-usb-c-type-c-cable-for-xiaomi-mi-10-pro-samsung-s20-macbook-ipad":"Baseus100WUSBCToUSBTypeCCableUSBCPDFastChargerCordUSB-CType-cCableForXiaomimi10ProSamsungS20MacbookiPad","baseus-cable-usb-para-iphone-12-11-pro-max-xs-x-8-plus-cable-de-carga-rapida-2p4a-para-iphone-7-se":"Baseus-CableUSBparaiPhone1211ProMaxXsX8PlusCabledecargarapida2p4AparaiPhone7SE","baseus-cable-usb-tipo-c-5a-para-huawei-p30-mate-30-pro-carga-r-pida-3-carga-r-pida-xiaomi-9-usb-c":"Baseus-CableUSBtipoC5AparaHuaweiP30Mate30Procargarápida3cargarápidaXiaomi9USB-C","baseus-cargador-usb-tipo-c-port-til-20w-compatible-con-tipo-c-pd-carga-r-pida-para-iphone-12-pro-max-11-mini-8-plus":"Baseus-cargadorUSBtipoCportátil,20W,compatiblecontipoC,PD,cargarápidaparaiPhone12ProMax11Mini8Plus","bath-mat-24-x-17-":"BathMat-24\"x17\"","bath-mat-34-x-21-":"BathMat-34\"x21\"","bath-mats":"BathMats","bath-towel":"BathTowel","bath-towels":"Bath&Towels","bathmat24x17":"BathMat-24\"x17\"","bathmat34x21":"BathMat-34\"x21\"","bathmats":"BathMats","bathtowel":"BathTowel","bathtowels":"BathTowels","beach-towel":"BeachTowel","beach-towels":"BeachTowels","beachtowel":"BeachTowel","beachtowels":"BeachTowels","bedcomforter104x88":"BedComforter104x88","bedcomforter68x88":"BedComforter68x88","bedcomforter68x92":"BedComforter68x92","bedcomforter88x88":"BedComforter88x88","bedding":"Bedding","belarus":"Belarus","belgium":"Belgium","belize":"Belize","bella-flowy-tank":"LadiesFlowyTank","bella-racerback-tank":"BellaRacerbackTank","benin":"Benin","bermuda":"Bermuda","berry":"Berry","bhutan":"Bhutan","bikini":"Bikini","birch":"Birch","black":"Black","black-green-wall-hanging-planter":"BlackGreenWallHangingPlanter","black-green-wall-hanging-planting-bs":"BlackGreenWallHangingPlantingBs","blog":"blog","blog-teechip-com":"blog.teechip.com","blog-teechip-comts=ts=":"blog.teechip.comts=ts=","blue":"Blue","bolivia":"Bolivia","bolivia,-plurinational-state-of":"Bolivia,PlurinationalStateOf","bonaire,-sint-eustatius-and-saba":"Bonaire,SintEustatiusandSaba","bosnia":"Bosnia","bosnia-and-herzegovina":"BosniaandHerzegovina","botswana":"Botswana","bottle":"Bottle","bouvet-island":"BouvetIsland","bracelets":"Bracelets","brazil":"Brazil","briefs":"Briefs","bright-pink":"BrightPink","brightpink":"BrightPink","british-indian-ocean-territory":"BritishIndianOceanTerritory","british-virgin-islands":"BritishVirginIslands","brown":"Brown","brunei":"Brunei","brunei-darussalam":"BruneiDarussalam","bulgaria":"Bulgaria","bumper-sticker":"BumperSticker","bumper-sticker-changed":"BumperStickerChanged","bundle":"CompleteYourBundleandSe","burkina-faso":"BurkinaFaso","burnt-orange":"BurntOrange","burntorange":"BurntOrange","burundi":"Burundi","cable-organizer-silicone-usb-cable-winder-deskt":"CableOrganizerSiliconeUSBCableWinderDeskt","cable-organizer-silicone-usb-cable-winder-deskt-3":"CableOrganizerSiliconeUSBCableWinderDeskt3","cambodia":"Cambodia","camel-sports-sandals-men-s-hiking-wading-sandals-men-comfortable-sports-outdoor-beach-summer-walking-sandals":"CAMELSportsSandalsMen'sHikingWadingSandalsMenComfortableSportsOutdoorBeachSummerWalkingSandals","cameroon":"Cameroon","campaign":"Campaign","camping-rain-jacket-men-women-waterproof-sun-protection-clothing-fishing-hunting-clothes-quick-dry-skin-with-pocket":"CampingRainJacketMenWomenWaterproofSunProtectionClothingFishingHuntingClothesQuickDrySkinWithPocket","canada":"Canada","canary-islands":"CanaryIslands","cancel":"Cancel","canvas-slip-ons":"CanvasSlipOns","cape-verde":"CapeVerde","car-phone-holder-support-stand-720-degree-rotation-car-mobile-phone-holder-with-parking-card-automotive-goods":"CarPhoneHolderSupportStand720DegreeRotationCarMobilePhoneHolderWithParkingCardAutomotiveGoods","caribbean-netherlands":"CaribbeanNetherlands","carolina-blue":"CarolinaBlue","carolinablue":"CarolinaBlue","cat-stuffed-toys":"CatStuffedToys","cayman-islands":"CaymanIslands","central-african-republic":"CentralAfricanRepublic","ceuta":"Ceuta","chad":"Chad","change":"Change","charcoal":"Charcoal","charcoal-grey":"CharcoalGrey","charcoalgrey":"CharcoalGrey","chile":"Chile","china":"China","chocolate":"Chocolate","christmas-island":"ChristmasIsland","christmas-stocking":"ChristmasStocking","circle-coaster":"CircleCoaster","circle-coasters":"Circlecoasters","circle-cutting-board":"CircleCuttingBoard","circle-earrings":"CircleEarrings","circle-mnet":"CircleMnet","circle-ornament-3-pieces-porcelain-":"Circleornament-3pieces(porcelain)","circle-ornament-3-pieces-wood-":"Circleornament-3pieces(wood)","circle-ornament-porcelain-":"CircleOrnament(Porcelain)","circle-ornament-single-porcelain-":"Circleornament-single(porcelain)","circle-ornament-single-wood-":"Circleornament-single(wood)","circle-ornament-wood-":"CircleOrnament(Wood)","circlecoaster":"CircleCoaster","circlecuttingboard":"CircleCuttingBoard","circleearrings":"CircleEarrings","circlemnet":"CircleMnet","classic-hat":"ClassicHat","classic-long-sleeve-tee":"LongSleeveTee","classic-pink":"ClassicPink","classic-polo":"ClassicPolo","classic-polo-tee":"ClassicPoloTee","classic-t-shirt":"ClassicT-Shirt","classic-tee":"ClassicTee","classic-tees":"ClassicTees","classichat":"ClassicHat","classicpink":"ClassicPink","classicpolo":"ClassicPolo","classicpolotee":"ClassicPoloTee","classictee":"ClassicTee","classictshirt":"ClassicT-Shirt","click-here":"Clickhere","cloth-face-mask":"Clothfacemask","cloth-face-mask-10-pack":"ClothFaceMask-10Pack","cloth-face-mask-3-pack":"ClothFaceMask-3Pack","cloth-face-mask-5-pack":"ClothFaceMask-5Pack","cm-centimeters":"CM","coasters":"Coasters","cocos-islands":"CocosIslands","colombia":"Colombia","color":"Color","color-1":"Color:1","color-12":"Color:12","color-12cm":"Color:12cm","color-2":"Color:2","color-6":"Color:6","color-7":"Color:7","color-8":"Color:8","color-9":"Color:9","color-a-orange-left-side":"Color:AOrangeLeftSide","color-a012-black":"Color:A012-Black","color-a012-blue":"Color:A012-Blue","color-a012-titanium":"Color:A012-Titanium","color-a017-black":"Color:A017-Black","color-as-ime-size-one-size":"Color:AsIme/Size:OneSize","color-beige-low-shoe-size-11":"Color:beigelow/ShoeSize:11","color-black":"Color:Black","color-black-size-30x45cm":"Color:Black/Size:30x45cm","color-black-tama-o-s":"Color:black/Tamaño:S","color-blue":"Color:Blue","color-blue-size-l":"Color:Blue/Size:L","color-blue-size-m":"Color:Blue/Size:M","color-blue-with-gamepad":"Color:BluewithGamepad","color-brown":"Color:Brown","color-changing-mug":"ColorChangingMug","color-changing-mugs":"ColorChangingMugs","color-coffee-size-s":"Color:coffee/Size:S","color-e-with-filter-stone-size-as-show":"Color:EWithfilterstone/Size:asshow","color-elephant":"Color:elephant","color-f":"Color:F","color-gps-hd1-and-6-acces":"Color:GPSHD1and6Acces","color-green":"Color:Green","color-hd1-and-8-acces":"Color:HD1and8Acces","color-hd1-and-cable":"Color:HD1andCable","color-k7-green-shoe-size-11":"Color:K7-green/ShoeSize:11","color-light-blue-size-s":"Color:LightBlue/Size:S","color-light-pink":"Color:LightPink","color-light-purple":"Color:lightpurple","color-purple":"Color:Purple","color-red":"Color:Red","color-sb20a-4pcs":"Color:SB20A4pcs","color-shb2-size-xxl":"Color:SHB2/Size:XXL","color-shb4-size-s":"Color:SHB4/Size:S","color-shb4-size-xxl":"Color:SHB4/Size:XXL","color-shd2-size-l":"Color:SHD2/Size:L","color-shda-size-l":"Color:SHDA/Size:L","color-shxg-size-xl":"Color:SHXG/Size:XL","color-style-a-blue":"Color:styleAblue","color-transparent":"Color:Transparent","color-tzm177-size-110":"Color:TZM177/Size:110","color-tzm178-size-4xl":"Color:TZM178/Size:4XL","color-unisex-2":"Color:Unisex2","color-unisex-black-size-l":"Color:Unisex-Black/Size:L","color-unisex-black-size-s":"Color:Unisex-Black/Size:S","color-unisex-blue-size-l":"Color:Unisex-Blue/Size:L","color-unisex-blue-size-xl":"Color:Unisex-Blue/Size:XL","color-unisex-gray-size-4xl":"Color:Unisex-Gray/Size:4XL","color-unisex-orange-size-l":"Color:Unisex-Orange/Size:L","color-unisex-orange-size-m":"Color:Unisex-Orange/Size:M","color-unisex-orange-size-s":"Color:Unisex-Orange/Size:S","color-unisex-rose-red-size-xxl":"Color:Unisex-RoseRed/Size:XXL","color-unisex-yellow-size-m":"Color:Unisex-Yellow/Size:M","color-unisex-yellow-size-xxxl":"Color:Unisex-Yellow/Size:XXXL","color-white":"Color:White","color-white-low-shoe-size-9":"Color:whitelow/ShoeSize:9","color-xp-14a-a1-size-m":"Color:XP-14A-A1/Size:M","color-xp-14a-a3-size-l":"Color:XP-14A-A3/Size:L","color-xp-14a-a7-size-xl":"Color:XP-14A-A7/Size:XL","colorchangingmug":"ColorChangingMug","colorchangingmugs":"ColorChangingMugs","colors":"colors","comforter-king":"Comforter-King","comforter-queen":"Comforter-Queen","comforter-twin":"Comforter-Twin","comforter-twin-xl":"Comforter-TwinXL","comforterking":"Comforter-King","comforterqueen":"Comforter-Queen","comforters":"Comforters","comfortertwin":"Comforter-Twin","comfortertwinxl":"Comforter-TwinXL","comoros":"Comoros","comoros-islands":"ComorosIslands","complex-aos-hoodie":"ComplexAOShoodie","congo,-the-democratic-republic-of-the":"Congo,theDemocraticRepublicofThe","congratulations":"Congratulations","contact-us":"Contactus","contour-vacuum-bottle":"ContourVacuumBottle","converse-tennis":"ConverseTennis","cook-islands":"CookIslands","cool-man-steampunk-skull-head-watch-men-3d-skeleton-engred-gold-black-mexico-punk-rock-dial-clock-relogio-masculino":"CoolManSteampunkSkullHeadWatchMen3DSkeletonEngredGoldBlackMexicoPunkRockDialClockrelogiomasculino","coral":"Coral","coral-sea":"CoralSea","coralfleeceblanket30x40":"CoralFleeceBlanket30x40","coralfleeceblanket60x80":"CoralFleeceBlanket60x80","cord-bracelet":"CordBracelet","cord-circle-bracelet":"CordCircleBracelet","cord-circle-necklace":"CordCircleNecklace","cord-diamond-necklace":"CordDiamondNecklace","cord-heart-necklace":"CordHeartNecklace","cord-necklaces":"CordNecklaces","cord-rectangle-necklace":"CordRectangleNecklace","cord-square-necklace":"CordSquareNecklace","cord-triangle-necklace":"CordTriangleNecklace","cordbracelet":"CordBracelet","cordcirclebracelet":"CordCircleBracelet","cordcirclenecklace":"CordCircleNecklace","corddiamondnecklace":"CordDiamondNecklace","cordheartnecklace":"CordHeartNecklace","cordnecklaces":"CordNecklaces","cordrectanglenecklace":"CordRectangleNecklace","cordsquarenecklace":"CordSquareNecklace","cordtrianglenecklace":"CordTriangleNecklace","corsette-perron":"Corsetteperron","corsette-perron-chiquito":"Corsetteperronchiquito","corsette-perron-medianito":"Corsetteperronmedianito","cosmic-astronaut-spaceman-silicone-case-for-apple-airpods-1-2-accessories-case-protective-cover-b-box":"CosmicAstronautSpacemanSiliconeCaseforAppleAirpods12AccessoriesCaseProtectiveCoverBBox","costa-rica":"CostaRica","coupon-field.applied":"Promotioncodeapplied.","coupon-field.apply":"Apply","coupon-field.apply-here":"Applyhere","coupon-field.coupon-code":"CouponCode","coupon-field.he-coupon-code":"Iheacouponcode","coupon-field.he-promo-code":"Heapromotioncode?","coupon-field.view-code":"Viewcode","crew-length-socks":"CrewLengthSocks","crewlengthsocks":"CrewLengthSocks","crewneck-shirt":"CrewneckShirt","crewneck-sweatshirt":"CrewneckSweatshirt","crewneckshirt":"CrewneckShirt","crewnecksweatshirt":"CrewneckSweatshirt","croatia":"Croatia","cryptographic-crop-tops-blancos-sin-mangas-con-cordones-para-mujer-top-sexy-de-punto-con-espalda-descubierta":"Cryptographic-CropTopsblancossinmangasconcordonesparamujerTopSexydepuntoconespaldadescubierta","cryptographic-vestido-negro-sin-mangas-para-mujer-vestido-sexy-ajustado-para-fiesta-y-discoteca-sin-espalda":"Cryptographic-vestidonegrosinmangasparamujervestidoSexyajustadoparafiestaydiscotecasinespalda","cryptographic-vestido-nigga":"Cryptographic-vestidonigga","cta-compliance-checkbox":"Checkingthisboxindicatesyouunderstandandreeto{brand}using,distributing,andpublishingyourreview.Youunderstandthat{brand}willnotshareyourfullnameorcontactinformationpublicly.","cuba":"Cuba","curacao":"Curacao","cute-bite-cartoon-cable-protector-for-iphone-x-data-cable-universal-cord-protection-protective-cover-usb-cable-winder":"CuteBiteCartoonCableProtectorforiPhoneXdatacableUniversalCordProtectionProtectiveCoverUSBCableWinder","cutting-boards":"CuttingBoards","cuttingboards":"CuttingBoards","cyber-pink":"CyberPink","cyberpink":"CyberPink","cycling-chain-breaker-cutter-pin-splitter-mtb-bicycle-removal-repair-tool":"CyclingChainBreakerCutterPinSplitterMTBBicycleRemovalRepairTool","cyprus":"Cyprus","czech-republic":"CzechRepublic","côte-d'ivoire":"Côted'Ivoire","daisy":"Daisy","dark-blue":"DarkBlue","dark-chocolate":"DarkChocolate","dark-green":"DarkGreen","darkblue":"DarkBlue","darkchocolate":"DarkChocolate","darkgreen":"DarkGreen","days":"days","decorative-pillows":"DecorativePillows","decorativepillow16x16":"DecorativePillow16x16","decorativepillow18x18":"DecorativePillow18x18","decorativepillows":"DecorativePillows","deep-forest":"DeepForest","deep-orange":"DeepOrange","deep-royal":"DeepRoyal","deeporange":"DeepOrange","denmark":"Denmark","department-big-&-tall":"Big&Tall","department.kids":"Kids","department.men":"Men","department.women":"Women","diy-1-30-assembling-building-kiasd-asd-as-das":"DIY1:30AssemblingBuildingKiasdasdasdas","diy-1-30-assembling-building-kits":"DIY1:30AssemblingBuildingKits","diy-hole-puncher-loose-leaf-hole-punch-handmade-loose-leaf-paper-hole-puncher-for-office":"DIYHolePuncherLooseLeafHolePunchHandmadeLoose-leafPaperHolePuncherforOffice","djibouti":"Djibouti","djustable-shoe-organizer-modern-double-shoe-rack-store-space-ser-shoes-organizers-stand-shelf-for-living-room":"djustableShoeOrganizerModernDoubleShoeRackStoreSpaceSerShoesOrganizersStandShelfforLivingRoom","dominica":"Dominica","dominican-republic":"DominicanRepublic","done":"Done","doormat-22.5-x-15-":"Doormat22.5\"x15\"","doormat-28-x-17-":"Doormat28\"x17\"","doormat-34-x-23-":"Doormat34\"x23\"","doormats":"Doormats","drawstring-b":"DrawstringB","drawstring-bs":"DrawstringBs","drawstringb":"DrawstringB","drawstringbs":"DrawstringBs","dress-shirt":"DressShirt","dresses":"Dresses","dressshirt":"DressShirt","drinkware":"Drinkware","duvet-cover-king":"DuvetCover-King","duvet-cover-queen":"DuvetCover-Queen","duvet-cover-twin":"DuvetCover-Twin","duvet-cover-twin-xl":"DuvetCover-TwinXL","duvet-covers":"DuvetCovers","duvetcoverking":"DuvetCover-King","duvetcoverqueen":"DuvetCover-Queen","duvetcovers":"DuvetCovers","duvetcovertwin":"DuvetCover-Twin","duvetcovertwinxl":"DuvetCover-TwinXL","earrings":"Earrings","easel-back-gallery-wrapped-canvas":"Easel-BackGalleryWrappedCanvas","ecuador":"Ecuador","edit":"Edit","edit.address":"EditAddress","egypt":"Egypt","el-salvador":"ElSalvador","electric-nail-trimmer":"ElectricNailTrimmer","electronic-chip-t-shirt":"ElectronicChipTShirt","email":"Email","embroidered-hat":"EmbroideredHat","embroideredhat":"EmbroideredHat","end-date":"Enddate","equatorial-guinea":"EquatorialGuinea","eritrea":"Eritrea","estonia":"Estonia","ethiopia":"Ethiopia","falkland-islands":"FalklandIslands","faq":"FAQ","faroe-islands":"FaroeIslands","features":"Features","fiji":"Fiji","filter":"Filter","finland":"Finland","fleece-blanket-30-x-40-":"FleeceBlanket-30\"x40\"","fleece-blanket-50-x-60-":"FleeceBlanket-50\"x60\"","fleece-blanket-60-x-80-":"FleeceBlanket-60\"x80\"","fleece-blankets":"FleeceBlankets","fleece-scarf":"FleeceScarf","fleeceblanket30x40":"FleeceBlanket-30\"x40\"","fleeceblanket60x80":"FleeceBlanket-60\"x80\"","fleeceblankets":"FleeceBlankets","flip-flops":"FlipFlops","floating-framed-canvas-prints-black":"FloatingFramedCanvasPrintsBlack","floating-framed-canvas-prints-white":"FloatingFramedCanvasPrintsWhite","floor-path-mold-1pc":"FloorPathMold-1pc","flowy-tank":"FlowyTank","flowytank":"FlowyTank","folding-stool":"FoldingStool","footer.about-us":"AboutUs","footer.address":"2900ShadelandeSuiteB1","footer.blog":"Blog","footer.chip-seller-blog":"ChipSellerBlog","footer.city":"Indianapolis,IN","footer.company":"Company","footer.contact-us":"ContactUs","footer.dmca":"DMCA","footer.explore":"Explore","footer.faq":"FAQ","footer.follow-us":"FollowUs","footer.full-address":"2900ShadelandeSuiteB1Indianapolis,IN","footer.help":"NeedHelp","footer.legacy-login":"LegacyLogin","footer.privacy-policy":"PrivacyPolicy","footer.returns-exchanges":"Shipping&ReturnPolicies","footer.returns-refunds-exchanges":"Shipping&ReturnPolicies\n","footer.sell-chip":"SellonChip","footer.sell-teechip":"SellonTeeChip","footer.service":"Service","footer.submit-request":"SubmitaRequest","footer.teechip-seller-blog":"TeeChipSellerBloTeeChip ‘Jos124; Loja de impressões personalizadas ‘Josep 124; camisetas, canecas, máscaras faciais, cartazes’g","footer.terms-and-conditions":"TermsandConditions","footer.terms-privacy":"Terms&Privacy","footer.track-order":"TrackOrder","footwear":"Footwear","forest":"Forest","forest-green":"ForestGreen","forestgreen":"ForestGreen","four-sided-volleyball-net-large":"FourSidedVolleyballNet-Large","four-sided-volleyball-net-standard":"FourSidedVolleyballNet-Standard","foxwell-nt650-elite-obd2-automotive-scanner-abs-srs-af-brt-dpf-oil-reset-professional-obd-auto-car-tool-obd2-scanner":"FOXWELLNT650EliteOBD2AutomotiveScannerABSSRSAFBRTDPFOilResetProfessionalOBDAutoCarToolOBD2Scanner","france":"France","french-guiana":"FrenchGuiana","french-polynesia":"FrenchPolynesia","french-southern-territories":"FrenchSouthernTerritories","frequently-bought-together-title":"FrequentlyBoughtTogether","from":"From","front":"SideName","fruit-of-the-loom-tee":"ClassicT-Shirt","fuchsia":"Fuchsia","full-lace-human-hair-wigs-hd-transparent-lace-frontal-wig-straight-lace-front-remy-4x4-closure-wig-for-black-women":"FullLaceHumanHairWigsHDTransparentLaceFrontalWigStraightLaceFrontRemy4x4ClosureWigForBlackWomen","funda-de-concha-de-perla-para-apple-airpods-1-2-3-funda-de-lujo-para-airpods-pro-accesorios-para-auriculares":"FundadeconchadeperlaparaAppleAirpods123,fundadelujoparaAirPodsPro,accesoriosparaauriculares","fuschia":"Fuschia","gabon":"Gabon","gaiter-scarf":"GaiterScarf","gaiterscarf":"GaiterScarf","gallery-wrapped-canvas-prints":"GalleryWrappedCanvasPrints","gambia":"Gambia","garment":"garment","georgia":"Georgia","germany":"Germany","ghana":"Ghana","gibraltar":"Gibraltar","gildan-hoodie":"HoodedSweatshirt","gildan-sleeveless-tee":"SleevelessTee","gildan-sweatshirt":"CrewneckSweatshirt","gildan-zip-hoodie":"GildanZipHoodie","girls-solid-color-big-rubber-band":"GirlsSolidColorBigRubberBand","gmasksl-retail.product-grouped.neck-gaiter":"NeckGaiter","gold":"Gold","gothic-tights-pantyhose-black-retro-rose-flower-vine-fishnet-lace-trousers-little-love-bottoming-g-stockings-women":"GothicTightsPantyhoseBlackRetroRoseFlowerVineFishnetLaceTrousersLittleLoveBottomingGStockingsWomen","grass-green":"GrassGreen","grassgreen":"GrassGreen","greece":"Greece","green":"Green","greenland":"Greenland","grenada":"Grenada","grey":"Grey","guadeloupe":"Guadeloupe","guam":"Guam","guatemala":"Guatemala","guernsey":"Guernsey","guinea":"Guinea","guinea-bissau":"Guinea-Bissau","guyana":"Guyana","haiti":"Haiti","hand-towel":"HandTowel","hand-towel-horizontal":"HandTowel(horizontal)","hand-towel-horizontal-":"HandTowel(horizontal)","hand-towels":"HandTowels","handheld-electric-cleaning-brush":"HandheldElectricCleaningBrush","handtowel":"HandTowel","handtowelhorizontal":"HandTowel(horizontal)","handtowels":"HandTowels","hanes-sweatshirt":"HanesSweatshirt","hanging-canvas":"HangingCanvas","hanging-flower-pot":"HangingFlowerPot","hat":"Hat","hats":"Hats","heard-island-and-mcdonald-islands":"HeardIslandandMcdonaldIslands","heart-ornament-3-pieces-porcelain-":"Heartornament-3pieces(porcelain)","heart-ornament-3-pieces-wood-":"Heartornament-3pieces(wood)","heart-ornament-porcelain-":"HeartOrnament(Porcelain)","heart-ornament-single-porcelain-":"Heartornament-single(porcelain)","heart-ornament-single-wood-":"Heartornament-single(wood)","heart-ornament-wood-":"HeartOrnament(Wood)","heated-lunchbox":"HeatedLunchbox","heather":"Heather","height-27cm-color-blue":"Height:27cm/Color:Blue","height-50cm-color-yellow":"Height:50cm/Color:Yellow","height-70cm-color-yellow":"Height:70cm/Color:Yellow","heliconia":"Heliconia","help-center":"Helpcenter","high-top-shoes":"HighTopShoes","high-waist-leggings":"HighWaistLeggings","holy-see-vatican-city-state":"HolySee(VaticanCityState)","home":"Home","home-&-living":"Home&Living","home-livi":"home-livi","home-living":"Home&Living","home-living-":"home-living.","home-living-pillows":"home-living.pillows","home-living.drinkware":"home-living.drinkware","home-living.drinkware.color-changing-mugs":"home-living.drinkware.color-changing-mugs","home-living.drinkware.color-changing-mugs.color-changing-mug":"home-living.drinkware.color-changing-mugs.color-changing-mug","home-living.drinkware.mugs":"home-living.drinkware.mugs","home-living.drinkware.mugs.mug":"home-living.drinkware.mugs.mug","home-living.drinkware.tumbler":"home-living.drinkware.tumbler","home-living.pillowcases":"Pillowcases","home-living.pillows-and-bedding.fleece-blankets.30x40":"home-living.pillows-and-bedding.fleece-blankets.30x40","home-living.pillows-and-bedding.fleece-blankets.30x40.30x40-fleece-blankets-coral":"home-living.pillows-and-bedding.fleece-blankets.30x40.30x40-fleece-blankets-coral","home-living.pillows-and-bedding.fleece-blankets.60x80":"home-living.pillows-and-bedding.fleece-blankets.60x80","home-living.pillows-and-bedding.fleece-blankets.60x80.60x80-fleece-blankets-coral":"home-living.pillows-and-bedding.fleece-blankets.60x80.60x80-fleece-blankets-coral","home-living.pillows-and-bedding.fleece-blankets.60x80.60x80-fleece-blankets-sherpa":"home-living.pillows-and-bedding.fleece-blankets.60x80.60x80-fleece-blankets-sherpa","home-living.pillows-and-bedding.quilts.quilt":"home-living.pillows-and-bedding.quilts.quilt","home-living.posters":"home-living.posters","home-living.posters.11-17":"home-living.posters.11-17","home-living.posters.16-24":"home-living.posters.16-24","home-living.posters.24-36":"home-living.posters.24-36","home-living.towels":"home-living.towels","home-living.towels.beach-towel":"home-living.towels.beach-towel","home-living.towels.hand-towel":"home-living.towels.hand-towel","home-living.wall-decoration":"home-living.wall-decoration","home-living.wall-decoration.posters":"home-living.wall-decoration.posters","home-living.wall-decoration.posters.11-17":"home-living.wall-decoration.posters.11-17","home-living.wall-decoration.posters.11-17.11x17-poster":"home-living.wall-decoration.posters.11-17.11x17-poster","home-living.wall-decoration.posters.16-24":"home-living.wall-decoration.posters.16-24","home-living.wall-decoration.posters.16-24.16x24-poster":"home-living.wall-decoration.posters.16-24.16x24-poster","home-living.wall-decoration.posters.17-11":"home-living.wall-decoration.posters.17-11","home-living.wall-decoration.posters.17-11.17x11-poster":"home-living.wall-decoration.posters.17-11.17x11-poster","home-living.wall-decoration.posters.24-36":"home-living.wall-decoration.posters.24-36","home-living.wall-decoration.posters.24-36.24x36-poster":"home-living.wall-decoration.posters.24-36.24x36-poster","home-women-thick-bottom-slippers-platform":"HomeWomenThickBottomSlippersPlatform","homeliving":"Home&Living","homelivingbathandtowels":"home-living.bath-and-towels","homelivingbathandtowelsbathmats":"home-living.bath-and-towels.bath-mats","homelivingbathandtowelsbathtowels":"home-living.bath-and-towels.bath-towels","homelivingbathandtowelsbeachtowels":"home-living.bath-and-towels.beach-towels","homelivingbathandtowelshandtowel":"home-living.bath-and-towels.hand-towel","homelivingbathandtowelshandtowels":"home-living.bath-and-towels.hand-towels","homelivingbathandtowelsshowercurtains":"home-living.bath-and-towels.shower-curtains","homelivingbathandtowelsteatowels":"home-living.bath-and-towels.tea-towels","homelivingbedding":"home-living.bedding","homelivingkitchenanddining":"home-living.kitchen-and-dining","homelivingkitchenanddiningaprons":"home-living.kitchen-and-dining.aprons","homelivingkitchenanddiningplacemats":"home-living.kitchen-and-dining.placemats","homelivingkitchenanddiningrunners":"home-living.kitchen-and-dining.runners","homelivingkitchenanddiningwovenrugs":"home-living.kitchen-and-dining.woven-rugs","homelivingpetbeds":"home-living.pet-beds","homelivingpillowcases":"home-living.pillowcases","homelivingpillowsandbedding":"home-living.pillows-and-bedding","homelivingpillowsandbeddingcomforters":"home-living.pillows-and-bedding.comforters","homelivingpillowsandbeddingdecorativepillows":"home-living.pillows-and-bedding.decorative-pillows","homelivingpillowsandbeddingduvetcovers":"home-living.pillows-and-bedding.duvet-covers","homelivingpillowsandbeddingfleeceblankets":"home-living.pillows-and-bedding.fleece-blankets","homelivingpillowsandbeddingpillowcases":"home-living.pillows-and-bedding.pillowcases","homelivingpillowsandbeddingpillowshams":"home-living.pillows-and-bedding.pillow-shams","homelivingposters":"home-living.posters","homelivingposters1117":"home-living.posters.11-17","homelivingposters1624":"home-living.posters.16-24","homelivingposters2436":"home-living.posters.24-36","homelivingtowels":"home-living.towels","homelivingtowelsbeachtowel":"home-living.towels.beach-towel","homelivingtowelshandtowel":"home-living.towels.hand-towel","homelivingwalldecoration":"home-living.wall-decoration","homelivingwalldecorationposters":"home-living.wall-decoration.posters","homelivingwalldecorationposters1117":"home-living.wall-decoration.posters.11-17","homelivingwalldecorationposters1624":"home-living.wall-decoration.posters.16-24","homelivingwalldecorationposters2436":"home-living.wall-decoration.posters.24-36","homelivingwalldecorationwalltapestries":"home-living.wall-decoration.wall-tapestries","homelivingwalldecorationwindowcurtains":"home-living.wall-decoration.window-curtains","honduras":"Honduras","hong-kong":"HongKong","hooded-blanket-l":"HoodedBlanketL","hooded-blankets":"HoodedBlankets","hooded-sweatshirt":"HoodedSweatshirt","hoodedsweatshirt":"HoodedSweatshirt","hoodie":"Hoodie","hoodies":"Hoodies","horizontal-poster":"HorizontalPoster","hungary":"Hungary","i-phone-4-4s-case":"iPhone4/4SCase","i-phone-5-5s-case":"iPhone5/5SCase","i-phone-5c-case":"iPhone5CCase","i-phone-6-6s-case":"iPhone6/6SCase","i-phone-6-plus-case":"iPhone6Plus/6SPlusCase","i-phone-7-case":"iPhone7Case","i-phone-7-plus-case":"iPhone7PlusCase","i-phone-8-case":"iPhone8Case","i-phone-8-plus-case":"iPhone8PlusCase","i-phone-se-2-case":"iPhoneSEGen2Case","i-phone-se-case":"iPhoneSEGen1Case","i-phone-x-case":"iPhoneXCase","i-phone-xr-case":"iPhoneXRCase","i-phone-xs-case":"iPhoneXSCase","i-phone-xs-max-case":"iPhoneXSMaxCase","iceland":"Iceland","in-inches":"IN","india":"India","indonesia":"Indonesia","indoor-pillow-16-x-16-":"IndoorPillow-16\"x16\"","indoor-pillow-18-x-18-":"IndoorPillow-18\"x18\"","indoorpillow16x16":"IndoorPillow-16\"x16\"","indoorpillow18x18":"IndoorPillow-18\"x18\"","infant-onesie":"InfantOnesie","infantonesie":"InfantOnesie","invoice.after-payment-received":"afterpaymentreceived","invoice.anchor-title":"Subtotal:","invoice.calculated-checkout":"Calculatedatcheckout","invoice.discount":"Discount","invoice.discounts":"Discount","invoice.email":"EnterEmailforExpressCheckout","invoice.order-estimated-to-deliver-between":"Orderestimatedtobedeliveredbetween{earliest}-{latest}","invoice.order-estimated-to-deliver-on":"Orderestimatedtobedeliveredon{earliest}","invoice.order-estimated-to-ship-after-payment":"Orderwill{ship}between{earliest}and{latest}{days}{afterPaymentReceived}","invoice.order-estimated-to-ship-as-early-as":"Orderwillshipasearlyas{earliest}","invoice.order-estimated-to-ship-between":"Orderwillshipbetween{earliest}and{latest}","invoice.order-estimated-to-ship-on":"Orderestimatedtoshipon{earliest}","invoice.order-holiday-shipping":"Feb14Paco","invoice.proceed-checkout":"ProceedtoCheckout","invoice.review-your-order":"ReviewYourOrder","invoice.shipping-fees":"Shipping&Fees","invoice.subtotal":"Subtotal","invoice.tax":"Tax","invoice.total":"Total","invoice.your-items":"YourItems","iphone-11":"iPhone11","iphone-11-pro":"iPhone11Pro","iphone-11-pro-max":"iPhone11ProMax","iphone-12-12-pro":"iPhone12/12Pro","iphone-12-mini":"iPhone12Mini","iphone-12-pro-max":"iPhone12ProMax","iphone-4-4s-case":"iPhone4/4SCase","iphone-5-5s-case":"iPhone5/5SCase","iphone-5c-case":"iPhone5CCase","iphone-6-6s-case":"iPhone6/6SCase","iphone-6-plus-case":"iPhone6PlusCase","iphone-7-case":"iPhone7Case","iphone-7-plus-case":"iPhone7PlusCase","iphone-8-case":"iPhone8Case","iphone-8-plus-case":"iPhone8PlusCase","iphone-se-gen-1-case":"iPhoneSEGen1Case","iphone-se-gen-2-case":"iPhoneSEGen2Case","iphone-x-case":"iPhoneXCase","iphone-xr-case":"iPhoneXRCase","iphone-xs-case":"iPhoneXSCase","iphone-xs-max-case":"iPhoneXSMaxCase","iphone44scase":"iPhone4/4SCase","iphone55scase":"iPhone5/5SCase","iphone5ccase":"iPhone5CCase","iphone66scase":"iPhone6/6SCase","iphone6pluscase":"iPhone6PlusCase","iphone7case":"iPhone7Case","iphone7pluscase":"iPhone7PlusCase","iphone8case":"iPhone8Case","iphonexcase":"iPhoneXCase","iphonexrcase":"iPhoneXRCase","iphonexscase":"iPhoneXSCase","iphonexsmaxcase":"iPhoneXSMaxCase","iran,-islamic-republic-of":"Iran,IslamicRepublicOf","iraq":"Iraq","ireland":"Ireland","irish-green":"IrishGreen","irishgreen":"IrishGreen","isle-of-man":"IsleofMan","israel":"Israel","italy":"Italy","item-added-to-cart":"Itemaddedtocart","item-ships-to-us-only":"ItemshipstoUSonly","items-added-to-cart":"Itemsaddedtocart","j-ny":"JNy","jacket":"Jacket","jamaica":"Jamaica","japan":"Japan","jersey":"Jersey","jerzees-sleeveless-tee":"JerzeesSleevelessTee","jewelry":"Jewelry","jewelry.bracelets.cord-bracelet":"jewelry.bracelets.cord-bracelet","jewelry.necklaces":"jewelry.necklaces","jewelry.necklaces.metallic-necklace":"jewelry.necklaces.metallic-necklace","jewelry.necklaces.metallic-necklace.metallic-circle-necklace":"jewelry.necklaces.metallic-necklace.metallic-circle-necklace","jewelry.necklaces.metallic-necklace.metallic-heart-necklace":"jewelry.necklaces.metallic-necklace.metallic-heart-necklace","jewelry.necklaces.metallic-necklace.metallic-rectangle-necklace":"jewelry.necklaces.metallic-necklace.metallic-rectangle-necklace","jny":"JNy","jordan":"Jordan","juguetes-chinos-2":"Jugueteschinos2","julin":"Julin","just-modal":"TodayOnly-JustForYou","just-upsell":"JustForYou","kazakhstan":"Kazakhstan","kelly":"Kelly","kelly-green":"KellyGreen","kellygreen":"KellyGreen","kenya":"Kenya","khaki":"Khaki","king":"King","king-quilt-bed-set":"KingQuiltBedSet","kiribati":"Kiribati","kitchen-cleaning-bathroom-toilet-kitchen-glass-wall-cleaning-bath-brush-handle-sponge-bath-ceramic-cleaning-tools":"KitchenCleaningBathroomToiletKitchenGlassWallCleaningBathBrushHandleSpongeBathCeramicCleaningTools","kitchen-dining":"Kitchen&Dining","kitchen-gadget-set-copper":"KitchenGadgetSetCopper","kitchendining":"Kitchen&Dining","kiwi":"Kiwi","knit-beanie":"KnitBeanie","knitbeanie":"KnitBeanie","korea,-democratic-people's-republic-of":"Korea,DemocraticPeople'sRepublicOf","korea,-republic-of":"Korea,RepublicOf","korean-irregular-lady-skirt-female-autumn-sweet-high-waist-mini-skirt-vinte-casual-women-plaid-skirt-chic-sashes":"KoreanIrregularLadySkirtFemaleAutumnSweetHighWaistMiniSkirtVinteCasualWomenPlaidSkirtChicSashes","kosovo":"Kosovo","kuwait":"Kuwait","kyrgyzstan":"Kyrgyzstan","lace-panties":"LacePanties","ladies-flowy-tank":"LadiesFlowyTank","ladies-flowy-tanks":"LadiesFlowyTanks","ladies-leggings":"LadiesLeggings","ladies-t-shirt":"LadiesT-Shirt","ladies-tee":"Ladiestee","ladies-tees":"LadiesTees","ladiesflowytank":"LadiesFlowyTank","ladiesleggings":"LadiesLeggings","ladiestshirt":"LadiesT-Shirt","laos":"Laos","large":"Large","large-capacity-folding-waterproof-trel-bs-tote-handb-trel-duffle-bs-women-multifunctional-trel-bs":"LargeCapacityFoldingWaterproofTrelBsToteHandbTrelDuffleBsWomenMultifunctionalTrelBs","large-fleece-blanket-60-x-80-":"LargeFleeceBlanket-60\"x80\"","large-sherpa-fleece-blanket-60-x-80-":"LargeSherpaFleeceBlanket-60\"x80\"","latvia":"Latvia","laundry-basket-medium":"LaundryBasket-Medium","laundry-basket-small":"LaundryBasket-Small","layout.gift-finder.view-recs":"SeeOurFather'sDayRecommendations","lb-pounds":"LB","lebanon":"Lebanon","leggings":"LadiesLeggings","lemegeton-stainless-steel-choker-custom":"LemegetonStainlessSteelChokerCustom","lesotho":"Lesotho","liberia":"Liberia","libya":"Libya","liechtenstein":"Liechtenstein","lifelike-3d-teddy-dog-women-plush-slippers-winter-warm-soft-sole-shoes-men-couples-home-ladies-indoor-slip-on-fur-slides":"Lifelike3dTeddyDogWomenPlushSlippersWinterWarmSoftSoleShoesMenCouplesHomeLadiesIndoorSlipOnFurSlides","lige-new-men-smart-watch-wristband-men-women-sport-clock-heart-rate-monitor-sleep-monitor-bluetooth-call-smartwatch-for-phone":"LIGENewMenSmartWatchWristbandMenWomenSportClockHeartRateMonitorSleepMonitorBluetoothCallSmartwatchforphone","light-blue":"LightBlue","light-oxford":"LightOxford","light-pink":"LightPink","light-up-water-bottle":"LightUpWaterBottle","lightblue":"LightBlue","lightpink":"LightPink","lightweight-jacket":"LightweightJacket","lightweightjacket":"LightweightJacket","lime":"Lime","lithuania":"Lithuania","log-in":"LogIn","log-into-your-seller-account":"Logintoyourselleraccount?","logout":"Logout","long-sleeve":"LongSleeve","long-sleeve-shirt":"Longsleeveshirt","long-sleeve-t-shirt":"Long-sleeveT-Shirt","long-sleeve-t-shirts":"Long-sleeveT-Shirts","long-sleeve-tee":"LongSleeveTee","long-sleeves":"LongSleeves","longsleeve":"LongSleeve","longsleevetee":"LongSleeveTee","low-top-shoes":"LowTopShoes","lrg":"Large","luxembourg":"Luxembourg","luxury-new-printed-color-matching-phopping-b-women-s-b-fashion-tote-handbs-large-capacity-one-shoulder-handbs":"LuxuryNewPrintedColorMatchingPhoppingBWomen'sBFashionToteHandbsLargeCapacityOne-ShoulderHandbs","macao":"Macao","macedonia":"Macedonia","madascar":"Madascar","madiera-island":"MadieraIsland","mnetic-suspension-physics-teaching-aids-assembly-experiment-student-handwor-material-teach-tools-handicraft-course":"MneticSuspensionPhysicsTeachingAidsAssemblyExperimentStudentHandworMaterialTeachToolsHandicraftCourse","mnets":"Mnets","mailackers-creator-expert-architecture-flying-ball":"MailackersCreatorExpertArchitectureFlyingBall","makeup-brush-15pcs-set":"MakeupBrush15pcsset","malawi":"Malawi","malaysia":"Malaysia","maldives":"Maldives","mali":"Mali","malta":"Malta","man":"man","maroon":"Maroon","marshall-islands":"MarshallIslands","martinique":"Martinique","masks":"Masks","mauritania":"Mauritania","mauritius":"Mauritius","mayotte-island":"MayotteIsland","md40-mnetic-drill-1100w-compact-electromnetic-drill-press-n-traction-550-rpm":"MD40MneticDrill1100WCompactElectromneticDrillPressNTraction550RPM","me":"me","med":"Medium","medium":"Medium","medium-leather-notebook":"Medium-LeatherNotebook","memory-foam-two-piece-cushion-set":"MemoryFoamTwoPieceCushionSet","men":"Men","men-":"men(","men--hoodies":"men.hoodies","men-.-l2-":"men(.:l2)(","men-.-l2-.-l3-":"men(.:l2)(.:l3)","men-hoodies-":"men.hoodies.","men-hoodies-panic":"men.hoodies.panic","men-hoodies-panic!-at-the-disco":"men.hoodiespanic!atthedisco","men-s":"Men's","men-s-2-in-1-fitness-shorts":"Men's2in1FitnessShorts","men-s-all-over-print-full-zip-hoodie":"Men'sAllOverPrintFullZipHoodie","men-s-all-over-print-hoodie":"Men'sAllOverPrintHoodie","men-s-all-over-printed-tank":"Men'sAll-OverPrintedTank","men-s-all-over-printed-tee":"Men'sAll-OverPrintedTee","men-s-aop-t-shirt-l":"Men'sAOPT-ShirtL","men-s-aop-t-shirt-m":"Men'sAOPT-ShirtM","men-s-aop-t-shirt-xl":"Men'sAOPT-ShirtXL","men-s-briefs":"Men'sBriefs","men-s-classic-tee":"Men'sClassicTee","men-s-flip-flops":"Men'sFlipFlops","men-s-high-top-shoes":"Men'sHighTopShoes","men-s-high-top-white-shoes":"Men'sHighTopWhiteShoes","men-s-hoodies":"Men'sHoodies","men-s-hoodies-edited":"Men'sHoodiesEDITED","men-s-low-top-shoes":"Men'sLowTopShoes","men-s-low-top-white-shoes":"Men'sLowTopWhiteShoes","men-s-premium-tee":"Men'sPremiumTee","men-s-sweatpants":"Men'sSweatpants","men-s-t-shirts":"Men'sT-Shirts","men-s-tank-tops":"Men'sTankTops","men-s-unisex-tank":"Men'sUnisexTank","men-s-v-neck-tee":"Men'sV-NeckTee","men-t-shirt-my-jfdaccount-com":"men.t-shirtMyJFDAccount.com","men-t-shirts-baseball-tee":"men.t-shirts.baseball-tee","men-t-shirts-premium-teeкупить-футболку-dream-theatr":"men.t-shirts.premium-teeкупитьфутболкуDreamTheatr","men.filtered":"men.filtered","men.filtered.features":"men.filtered.features","men.footwear":"men.footwear","men.footwear.shoes.canvas-slip-ons":"men.footwear.shoes.canvas-slip-ons","men.footwear.shoes.flip-flops":"men.footwear.shoes.flip-flops","men.footwear.shoes.men-high-top-shoes":"men.footwear.shoes.men-high-top-shoes","men.footwear.shoes.men-low-top-shoes":"men.footwear.shoes.men-low-top-shoes","men.footwear.socks":"men.footwear.socks","men.footwear.socks.sock":"men.footwear.socks.sock","men.hoodies":"men.hoodies","men.hoodies.hoodie":"men.hoodies.hoodie","men.hoodies.men-hoodie":"men.hoodies.men-hoodie","men.long-sleeve.crewneck-shirt.longsleeve":"men.long-sleeve.crewneck-shirt.longsleeve","men.sweatpants":"men.sweatpants","men.sweatpants.sweatpant":"men.sweatpants.sweatpant","men.t-shirts":"MenT-Shirts","men.t-shirts.all-over-glaed-tee":"men.t-shirts.all-over--glaed-tee","men.t-shirts.all-over-glaed-tee.aos-shirt":"men.t-shirts.all-over--glaed-tee.aos-shirt","men.t-shirts.all-over-print-shirts":"men.t-shirts.all-over-print-shirts","men.t-shirts.all-over-print-shirts.l":"men.t-shirts.all-over-print-shirts.l","men.t-shirts.all-over-print-shirts.m":"men.t-shirts.all-over-print-shirts.m","men.t-shirts.all-over-print-shirts.xl":"men.t-shirts.all-over-print-shirts.xl","men.t-shirts.classic-polo":"men.t-shirts.classic-polo","men.t-shirts.classic-polo.classic-polo":"men.t-shirts.classic-polo.classic-polo","men.t-shirts.classic-tee":"ClassicT-Shirt","men.t-shirts.premium-tee":"PremiumTee","men.t-shirts.premium-tee.premium-fitted":"men.t-shirts.premium-tee.premium-fitted","men.t-shirts.vneck-tee":"men.t-shirts.vneck-tee","men.t-shirts.vneck-tee.v-neck-shirt":"men.t-shirts.vneck-tee.v-neck-shirt","men.tank-tops":"men.tank-tops","men.tank-tops.all-over-printed-tank":"men.tank-tops.all-over-printed-tank","men.tank-tops.all-over-printed-tank.all-over-tanktop":"men.tank-tops.all-over-printed-tank.all-over-tanktop","men.tank-tops.unisex-tank":"men.tank-tops.unisex-tank","men.tank-tops.unisex-tank.tanktop":"men.tank-tops.unisex-tank.tanktop","men.underwear":"men.underwear","men.underwear.boxer":"men.underwear.boxer","mens-all-over-printed-tank":"Men'sAll-OverPrintedTank","mens-all-over-printed-tee":"Men'sAll-OverPrintedTee","mens-classic-polo-tee":"Men'sClassicPoloTee","mens-classic-tee":"Men'sClassicTee","mens-dress-shirt":"Men'sDressShirt","mens-hoodies":"Men'sHoodies","mens-lightweight-jacket":"Men'sLightweightJacket","mens-long-sleeve":"Men'sLongSleeve","mens-premium-tee":"Men'sPremiumTee","mens-sweatshirts":"Men'sSweatshirts","mens-t-shirts":"Men'sT-Shirts","mens-tank-tops":"Men'sTankTops","mens-unisex-tank":"Men'sUnisexTank","mens-v-neck-tee":"Men'sV-NeckTee","mensalloverprintedtank":"Men'sAll-OverPrintedTank","mensalloverprintedtee":"Men'sAll-OverPrintedTee","mensclassicpolotee":"Men'sClassicPoloTee","mensclassictee":"Men'sClassicTee","mensocks":"men.socks","menstanktops":"Men'sTankTops","menstshirts":"Men'sT-Shirts","mentanktop":"men.tank-top","metal-color-black-gun-plated":"MetalColor:BlackGunPlated","metal-color-gold-color":"MetalColor:Gold-color","metal-color-rose-gold-color":"MetalColor:RoseGoldColor","metallic-bracelet":"MetallicBracelet","metallic-circle-bracelet":"MetallicCircleBracelet","metallic-circle-necklace":"MetallicCircleNecklace","metallic-diamond-necklace":"MetallicDiamondNecklace","metallic-heart-necklace":"MetallicHeartNecklace","metallic-necklaces":"MetallicNecklaces","metallic-rectangle-necklace":"MetallicRectangleNecklace","metallic-square-necklace":"MetallicSquareNecklace","metallic-triangle-necklace":"MetallicTriangleNecklace","metallicbracelet":"MetallicBracelet","metalliccirclebracelet":"MetallicCircleBracelet","metalliccirclenecklace":"MetallicCircleNecklace","metallicdiamondnecklace":"MetallicDiamondNecklace","metallicheartnecklace":"MetallicHeartNecklace","metallicnecklaces":"MetallicNecklaces","metallicrectanglenecklace":"MetallicRectangleNecklace","metallicsquarenecklace":"MetallicSquareNecklace","metallictrianglenecklace":"MetallicTriangleNecklace","mexico":"Mexico","micronesia":"Micronesia","midnight":"Midnight","mighty-power-hose-nozzle":"MightyPowerHoseNozzle","minutes":"Minutes","mirror-nail-stamper-clear-silicone-scraper-polish-transfer-template-kits-with-cap-nail-art-stamping-plate-ch1033-1":"MirrorNailStamperClearSiliconeScraperPolishTransferTemplateKitswithCapNailArtStampingPlateCH1033-1","miss":"Don'tMissOut!","moldova":"Moldova","monaco":"Monaco","mongolia":"Mongolia","montenegro":"Montenegro","montserrat":"Montserrat","more":"More","morocco":"Morocco","mother-necklace-women-jewellry-mother-s-day-gift-i-love-you-to-the-moon-and-back-heart-necklaces-to-my-mom-birthday":"MotherNecklaceWomenJewellryMother'sDayGiftiloveyoutothemoonandbackHeartNecklacesToMyMomBirthday","motorcycle-helmet-men-motocross-helmet-atv-full-face-moto-helmet-cross-downhill-off-road-helmet-men-casco-moto-ece":"MotorcycleHelmetMenMotocrossHelmetATVFullFaceMotoHelmetCrossDownhillOff-roadHelmetMenCascoMotoECE","mousepad":"Mousepad","mousepads":"Mousepads","movie-dinosaur-world-series-moc-tyrannosaurus":"MovieDinosaurWorldSeriesMOCTyrannosaurus","mozambique":"Mozambique","mug":"Mug","mugs":"Mugs","mugts=":"mugts=","my-account":"MyAccount","my-orders":"MyOrders","my-settings":"MySettings","myanmar":"Myanmar","name":"Fullname","namibia":"Namibia","natural":"Natural","nauru":"Nauru","n-bar.11x17-poster":"11x17\"Posters","n-bar.16x24-poster":"16x24\"Posters","n-bar.24x36-poster":"24x36\"Posters","n-bar.accesory-puches":"AccesoryPuches","n-bar.accessories":"Accessories","n-bar.accessory-pouches":"AccessoryPouches","n-bar.account":"Account","n-bar.all-unisex-shirts":"AllOverUnisexShirts","n-bar.all-unisex-tanks":"AllOverUnisexTanks","n-bar.animals":"Animals","n-bar.aprons":"Aprons","n-bar.babbies":"JustforBabbies","n-bar.babies":"BabyShower","n-bar.backpack":"Backpack","n-bar.bs":"Bs","n-bar.bath-and-towels":"BathandTowels","n-bar.bath-mats":"BathMats","n-bar.bath-towels":"BathTowels","n-bar.beach-towels":"BeachTowels","n-bar.black-floating-framed-canvas-wrap-print":"FloatingFramedCanvasPrintsBlack","n-bar.bracelets":"Bracelets","n-bar.canvas-wrap-print":"GalleryWrappedCanvasPrints","n-bar.classic-polo":"ClassicPolo","n-bar.classic-tees":"ClassicTees","n-bar.coasters":"Coasters","n-bar.color-changing-mugs":"ColorChangingMugs","n-bar.comforters":"Comforters","n-bar.cord-bracelets":"CordBracelets","n-bar.cord-necklaces":"CordNecklaces","n-bar.cutting-boards":"CuttingBoards","n-bar.decorative-pillows":"DecorativePillows","n-bar.drawstring-bs":"DrawstringBs","n-bar.dress-shirt":"Dressshirt","n-bar.dresses":"Dresses","n-bar.drinkware":"Drinkware","n-bar.duvet-covers":"DuvetCovers","n-bar.earrings":"Earrings","n-bar.easel-back-canvas-print":"Easel-BackGalleryWrappedCanvas","n-bar.eleven-seventeen-poster":"11x17\"Posters","n-bar.embroidered-hat":"EmbroideredHat","n-bar.family-relationships":"Family&Relationships","n-bar.fathers.day":"Father'sDay","n-bar.fleece-blankets":"FleeceBlankets","n-bar.footwear":"Footwear","n-bar.hand-towel":"HandTowel","n-bar.hand-towels":"HandTowels","n-bar.hanging-canvas-print":"HangingCanvas","n-bar.hats":"Hats","n-bar.holidays":"Holidays","n-bar.home-living":"Home&Living","n-bar.hoodies":"Hoodies","n-bar.jewelry":"Jewelry","n-bar.jobs":"Jobs","n-bar.july.birthday":"JulyBirthdays","n-bar.june.birthday":"JuneBirthdays","n-bar.kitchen-and-dining":"KitchenandDining","n-bar.knit-beanie":"KnitBeanie","n-bar.ladies-flowy-tanks":"LadiesFlowyTanks","n-bar.ladies-tees":"LadiesTees","n-bar.leggings":"Leggings","n-bar.lightweight-jacket":"LightweightJacket","n-bar.log-in-sign-up":"LogIn/SignUp","n-bar.log-out":"LogOut","n-bar.login":"Login","n-bar.logout":"Logout","n-bar.long-sleeves":"LongSleeves","n-bar.mnets":"Mnets","n-bar.masks":"Masks","n-bar.may.birthday":"MayBirthdays","n-bar.men":"Men","n-bar.men-shoes":"Men'sShoes","n-bar.metallic-bracelets":"MetallicBracelets","n-bar.metallic-necklaces":"MetallicNecklaces","n-bar.mothers":"Mother'sDay","n-bar.mousepads":"Mousepads","n-bar.mugs":"Mugs","n-bar.my-account":"MyAccount","n-bar.neck-gaiter":"NeckGaiter","n-bar.necklaces":"Necklaces","n-bar.onesies":"Onesies","n-bar.pet-beds":"PetBeds","n-bar.phonecases":"PhoneCases","n-bar.pillow-shams":"PillowShams","n-bar.pillowcases":"Pillowcases","n-bar.pillows-and-bedding":"PillowsandBedding","n-bar.placemats":"Placemats","n-bar.places":"Places","n-bar.popular":"Popular","n-bar.popular-searches":"PopularSearches","n-bar.posters":"Posters","n-bar.premium-fitted-tees":"PremiumFittedTees","n-bar.premium-ladies-tees":"PremiumFittedLadiesTees","n-bar.puzzle":"Puzzles","n-bar.quilts":"Quilts","n-bar.relationships":"Relationships","n-bar.runners":"Runners","n-bar.sale":"SALE","n-bar.search-place-holder":"Whatareyoulookingfor?","n-bar.shirts":"T-Shirts","n-bar.shower-curtains":"ShowerCurtains","n-bar.sign-up":"LogIn/SignUp","n-bar.sixteen-twentyfour-poster":"16x24\"Posters","n-bar.sling-pack":"SlingPack","n-bar.socks":"Socks","n-bar.sweatshirts":"Sweatshirts","n-bar.t-shirts":"T-Shirts","n-bar.tank-tops":"TankTops","n-bar.tea-towels":"TeaTowels","n-bar.ties":"Ties","n-bar.tote-bs":"ToteBs","n-bar.towels":"Towels","n-bar.track-order":"TrackOrder","n-bar.twentyfour-thirtysix-poster":"24x36\"Posters","n-bar.unisex-tanks":"UnisexTanks","n-bar.v-neck-shirts":"V-NeckShirts","n-bar.wall-decoration":"WallDecoration","n-bar.wall-tapestries":"WallTapestries","n-bar.weekender-tote":"WeekenderTote","n-bar.white-floating-framed-canvas-wrap-print":"FloatingFramedCanvasPrintsWhite","n-bar.window-curtains":"WindowCurtains","n-bar.women":"Women","n-bar.women-shoes":"Women'sShoes","n-bar.woven-rugs":"WovenRugs","n-bar.yoga-mat":"YogaMat","n-bar.youth-baby":"Youth&Baby","n-bar.youth-t-shirts":"YouthT-Shirts","n.all-over-print-dresses":"AllOverPrintDresses","n.all-over-print-shirts":"AllOverPrintShirts","n.all-over-print-tanktop":"AllOverPrintTanks","n.area-rugs":"AreaRugs","n.bed-sets":"BedSets","n.bottle":"Bottle","n.car":"Car","n.car-seat-cover":"CarSeatCovers","n.car-seat-covers":"CarSeatCovers","n.car-seat-organizer":"CarSeatOrganizer","n.car-seat-organizers":"CarSeatOrganizers","n.christmas-stocking":"ChristmasStockings","n.christmas-stockings":"ChristmasStockings","n.clocks":"Clocks","n.doormat-22-5x15":"Doormat22.5\"x15\"","n.doormats":"Doormats","n.drinkware/color-changing-mugs":"ColorChangingMugs","n.drinkware/mugs":"Mugs","n.fls":"Fls","n.folding-stool":"FoldingStool","n.hooded-blankets":"HoodedBlankets","n.laundry-basket":"LaundryBasket","n.laundry-baskets":"LaundryBaskets","n.lawn-sign":"LawnSign","n.lugge-covers":"LuggeCovers","n.notebooks":"Notebooks","n.onesies":"Onesies","n.ornaments":"Ornaments","n.pillows-bedding":"Pillows&Bedding","n.pint-glass":"PintGlasses","n.print-glass":"PintGlasses","n.purse":"Purse","n.puzzles":"Puzzles","n.quilt-bed-sets":"QuiltBedSets","n.scarves":"Scarves","n.sleeve-blankets":"SleeveBlankets","n.stickers":"Stickers","n.stockings":"ChristmasStockings","n.sweatpants":"Sweatpants","n.tumbler":"Tumblers","n.underwear":"Underwear","n.wallets":"Wallets","n.wooden-prints":"WoodenPrints","n.woven-blankets":"WovenBlankets","n.yard-signs":"YardSigns","ny":"Ny","neck-gaiter":"NeckGaiter","neck-gaiter-3-pack":"NeckGaiter-3Pack","neck-gaiter-5-pack":"NeckGaiter-5Pack","necklaces":"Necklaces","neon-green":"NeonGreen","neon-pink":"NeonPink","neon-yellow":"NeonYellow","neonpink":"NeonPink","neonyellow":"NeonYellow","nepal":"Nepal","netherlands":"Netherlands","new-caledonia":"NewCaledonia","new-design-red-laser-mask-flashing-el-wire-mask-movie-character-glowing-mask-halloween-party-show-accessories":"NewDesignRedLaserMaskFlashingELWireMaskMovieCharacterGlowingMaskHalloweenPartyShowAccessories","new-women-trel-b-large-capacity":"NewWomenTrelBLargeCapacity","new-zealand":"NewZealand","next":"Next","nicarua":"Nicarua","niger":"Niger","nigeria":"Nigeria","nike-hat":"NikeHat","nikehat":"NikeHat","nintend-switch-dock-cover-sleeve-dock-sock-de":"NintendSwitchDockCoverSleeveDockSockDe","niue":"Niue","no-search-result-for":"Nosearchresultsfor{query}","norfolk-island":"NorfolkIsland","northern-mariana-islands":"NorthernMarianaIslands","norway":"Norway","not-applicable":"Notapplicable","notebooks":"Notebooks","num-products":"{count}{count,plural,one{product}other{products}}","oceanblue":"OceanBlue","okay":"Okay","oman":"Oman","onesie":"Onesie","onesies":"Onesies","orange":"Orange","order-item":"Item","order.product.personalizable":"Personalizable","ornaments":"Ornaments","orthopedic-hip-cushion":"OrthopedicHipCushion","pe-not-found":"Penotfound","pakistan":"Pakistan","palau":"Palau","palestine,-state-of":"Palestine,StateOf","panama":"Panama","papua-new-guinea":"PapuaNewGuinea","paruay":"Paruay","pebble":"Pebble","pepillo":"Pepillo","personalizable":"Personalizable","personalizable-":"Personalizable/","personalizable.edit-design":"EditYourDesign","personalizable.personalizable-t":"Personalizable","peru":"Peru","pet-bed-cover-large":"PetBedCover-Large","pet-bed-cover-medium":"PetBedCover-Medium","pet-bed-cover-small":"PetBedCover-Small","pet-bed-large":"PetBed-Large","pet-bed-medium":"PetBed-Medium","pet-bed-small":"PetBed-Small","pet-beds":"PetBeds","pet-dog-baseball-sun-cap-with-ear-holes-for-small-medium-large-dog":"PetDogBaseballSunCapWithEarHolesForsmallmediumlargedog","pet-toothbrush":"PetToothbrush","petbed40x30":"PetBed40x30","petbed50x40":"PetBed50x40","petbedcoverlarge":"PetBedCover-Large","petbedcovermedium":"PetBedCover-Medium","petbedcoversmall":"PetBedCover-Small","petbedlarge":"PetBed-Large","petbedmedium":"PetBed-Medium","petbeds":"PetBeds","petbedsmall":"PetBed-Small","philippines":"Philippines","phone":"Phone","phone-case":"PhoneCase","phone-cases":"PhoneCases","phone-number":"PhoneNumber","phonecase":"PhoneCase","phonecases":"PhoneCases","pick-the-perfect-gift-for-fathers-day!":"PickthePerfectGiftforFather'sDay!","pillow-sham-king":"PillowSham-King","pillow-sham-standard":"PillowSham-Standard","pillow-shams":"PillowShams","pillowcases":"Pillowcases","pillows-bedding":"Pillows&Bedding","pillowsbedding":"Pillows&Bedding","pillowshamking":"PillowSham-King","pillowshams":"PillowShams","pillowshamstandard":"PillowSham-Standard","pink":"Pink","pins-gx16-2pins":"Pins:GX162Pins","pins-gx16-3pin":"Pins:GX163Pin","pins-gx16-3pins":"Pins:GX163Pins","pins-gx16-6pins":"Pins:GX166Pins","pint-glasses":"PintGlasses","pistola-de-masaje-100-muscular-de-tejido-profundo":"Pistolademasaje100musculardetejidoprofundo","pistola-de-masaje-muscular-de-tejido-profundo":"Pistolademasajemusculardetejidoprofundo","pitcairn-islands":"PitcairnIslands","placemat":"Placemat","placemats":"Placemats","plug-type-eu":"PlugType:EU","poland":"Poland","polo":"Polo","popular":"Popular","portugal":"Portugal","poster":"Poster","posters":"Posters","prank-spider-spider":"PrankSpider-Spider","premium-beach-towel":"PremiumBeachTowel","premium-fit-ladies-tee":"PremiumFitLadiesTee","premium-fit-mens-tee":"PremiumFitMensTee","premium-fitted":"Premiumfitted","premium-fitted-ladies-tee":"Premiumfittedladiestee","premium-fitted-ladies-tees":"PremiumFittedLadiesTees","premium-fitted-tees":"PremiumFittedTees","premium-tee":"PremiumTee","premiumbeachtowel":"PremiumBeachTowel","premiumfitladiestee":"PremiumFitLadiesTee","premiumfitmenstee":"PremiumFitMensTee","premiumtee":"PremiumTee","previous":"Previous","price":"Price","print-glass":"PrintGlass","print-glasses":"PrintGlasses","prints":"prints","product":"Product","products":"Products","products.acrylic-plaque":"Acrylicplaque","products.all-over-print-leggings":"All-overprintleggings","products.all-over-print-t-shirt":"All-overprintt-shirt","products.all-over-print-tanks":"All-overprinttanks","products.bamboo-cutting-boards":"Bamboocuttingboards","products.blankets":"Blankets","products.infant-onesies":"Onesies","products.pillow-cases":"Pillowcases","products.socks":"Socks","products.stainless-steel-flask":"Stainlesssteelflasks","products.towels":"Towels","puerto-rico":"PuertoRico","purple":"Purple","purplets=":"purplets=","puzzles":"Puzzles","qatar":"Qatar","qty":"Qty","quantity":"Quantity","queen":"Queen","queen-quilt-bed-set":"QueenQuiltBedSet","quilt-40-x50-baby":"Quilt40\"x50\"-Baby","quilt-50-x60-throw":"Quilt50\"x60\"-Throw","quilt-60-x70-twin":"Quilt60\"x70\"-Twin","quilt-70-x80-queen":"Quilt70\"x80\"-Queen","quilt-bed-sets":"QuiltBedSets","quilt40x50":"Quilt40\"x50\"","quilt50x60":"Quilt50\"x60\"","quilt60x70":"Quilt60\"x70\"","quilt70x80":"Quilt70\"x80\"","quilts":"Quilts","qwelkqwjlqj-rqlwk-ej-r-lqwkejr-lkqwjer-lkqwej-wwe":"qwelkqwjlqjrqlwk;ejr;lqwkejr;lkqwjer;lkqwejwwe","racerback-tank-dress-l":"RacerbackTankDressL","racerback-tank-dress-m":"RacerbackTankDressM","racerback-tank-dress-s":"RacerbackTankDressS","racerback-tanktop-l":"RacerbackTanktopL","racerback-tanktop-m":"RacerbackTanktopM","racerback-tanktop-s":"RacerbackTanktopS","rain-cover-universal-type-wifi-doorbell":"RainCoverUniversalTypeWifiDoorbell","receipt.international.shippment":"Yourordermaystillbeintransitafterpassingcustoms.","receipt.payment.euro-pending":"EUpaymentmethodssuchasGiropayandSofortarelikelytoexperienceadelay.Wewillproceedwithyourorderassoonasthepaymenthasbeenreceived.Thankyouforshoppingwithus.","rectangle-cutting-board":"RectangleCuttingBoard","rectanglecuttingboard":"RectangleCuttingBoard","rectangular-pillowcase":"RectangularPillowcase","rectangularpillowcase":"RectangularPillowcase","red":"Red","related":"AddThisRelatedItemAndSe","relaxed-fit-ladies-tee":"LadiesT-Shirt","remove":"Remove","required":"Required","reset":"Reset","retail.product.directory":"ShopbyProduct","retail.products.directory":"ShopbyProduct","retail.reviews.directory":"ReviewsDirectory","retail.reviews.teechip":"TeeChipReviews","retail.shopByProduct.directory":"ShopbyProduct","retail.storefronts.directory":"Storefrontsdirectory","retail.storefronts.popular":"PopularStorefronts","retail.ts.directory":"Tsdirectory","retevis-ailunce-hd1-dmr-radio-digital-walkie-talkie-ham-radio-amateur-vhf-uhf-dual-band-dmr-two-way-radio-communicator":"RETEVISAilunceHD1DMRRadioDigitalWalkieTalkieHamRadioAmateurVHFUHFDualBandDMRTwo-WayRadioCommunicator","retro-portable-mini-handheld-video-game-console-8-bit-3-inch-color-lcd-kids-color-game-player-built-in-400-games":"RetroPortableMiniHandheldVideoGameConsole8-Bit3InchColorLCDKidsColorGamePlayerBuilt-in400games","retro-portable-mini-video-game-console-inch-color-lcd-kids-color-game-player-built-in-400-games":"RetroPortableMiniVideoGameConsoleInchColorLCDKidsColorGamePlayerBuilt-in400games","reunion":"Reunion","reusable-hair-lint-catcher":"ReusableHairLintCatcher","review-not-so-great":"We'resorrywedidn'tmeetyourexpectations.Letusknowhowwecanimprove.","review.customer-service":"CustomerService","review.lee-a-review":"LeeaReview","review.lee-third-party-review":"LeeaThird-PartyReview","review.optional":"Optional","review.print-quality":"PrintQuality","review.product-quality":"ProductQuality","review.required":"Required","review.shipping-quality":"ShippingQuality","review.submit":"Submit","review.thank-you-for-giving-feedback":"Thankyouforyourfeedback!","review.would-you-consider-leing-third-party-review":"Wouldyouconsiderleingathird-partyreviewfor{brand}?\nThismakesabigdifferenceinhelpingusimproveandhelpingothersdiscoverus.Thankyou!","review.would-you-consider-leing-third-party-review-masks-less-than-5":"Weappreciateyourtimeandsincerelyvalueyouropinion.Ourgoalistokeepourcustomershappy,andwe’llbeusingtheinformationyouprovidedtodojustthat.Also,don’tforgetthatwe’llbenotifyingthewinnerofthe$1000prizeon{contest}.Goodlucktoyou!","review.would-you-consider-leing-third-party-review-masks-more-than-5":"We’llbenotifyingthewinnerofthe$1000prizeon{contest}.Inthemeantime,wouldyouconsiderleingathird-partyreviewfor{brand}?Thismakesabigdifferenceinhelpingusimproveandhelpingothersdiscoverus.Thankyou!","review.your-comments-help-us-improve":"Yourcommentshelpusimprove.","romania":"Romania","rose-red":"RoseRed","royal":"Royal","royal-blue":"RoyalBlue","royalblue":"RoyalBlue","runners":"Runners","russia":"Russia","rwanda":"Rwanda","safety-green":"SafetyGreen","saint-barthélemy":"SaintBarthélemy","saint-helena,-ascension-and-tristan-da-cunha":"SaintHelena,AscensionandTristanDaCunha","saint-kitts-and-nevis":"SaintKittsandNevis","saint-lucia":"SaintLucia","saint-martin-french-part":"SaintMartin(FrenchPart)","saint-pierre-and-miquelon":"SaintPierreandMiquelon","saint-vincent-and-the-grenadines":"SaintVincentandtheGrenadines","samoa":"Samoa","samsung-galaxy-s10":"SamsungGalaxyS10","samsung-galaxy-s10-plus":"SamsungGalaxyS10Plus","samsung-galaxy-s20":"SamsungGalaxyS20","samsung-galaxy-s20-plus":"SamsungGalaxyS20Plus","samsung-galaxy-s20-ultra":"SamsungGalaxyS20Ultra","samsung-galaxy-s3-case":"GalaxyS3Case","samsung-galaxy-s4-case":"GalaxyS4Case","samsung-galaxy-s5-case":"GalaxyS5Case","samsung-galaxy-s6-case":"GalaxyS6Case","samsung-galaxy-s6-edge-case":"GalaxyS6EdgeCase","samsung-galaxy-s6-edge-plus-case":"GalaxyS6EdgePlusCase","samsung-galaxy-s7-case":"GalaxyS7Case","samsung-galaxy-s7-edge-case":"GalaxyS7EdgeCase","samsung-galaxy-s8-case":"SamsungGalaxyS8Case","samsung-galaxy-s8-plus-case":"SamsungGalaxyS8PlusCase","samsung-galaxy-s9-case":"SamsungGalaxyS9Case","samsung-galaxy-s9-plus-case":"SamsungGalaxyS9PlusCase","samsunggalaxys3case":"SamsungGalaxyS3Case","samsunggalaxys4case":"SamsungGalaxyS4Case","samsunggalaxys5case":"SamsungGalaxyS5Case","samsunggalaxys6case":"SamsungGalaxyS6Case","samsunggalaxys6edgecase":"SamsungGalaxyS6EdgeCase","samsunggalaxys6edgepluscase":"SamsungGalaxyS6EdgePlusCase","samsunggalaxys7case":"SamsungGalaxyS7Case","samsunggalaxys7edgecase":"SamsungGalaxyS7EdgeCase","samsunggalaxys8case":"SamsungGalaxyS8Case","samsunggalaxys8pluscase":"SamsungGalaxyS8PlusCase","samsunggalaxys9case":"SamsungGalaxyS9Case","samsunggalaxys9pluscase":"SamsungGalaxyS9PlusCase","san-marino":"SanMarino","sandals":"Sandals","sao-tome-and-principe":"SaoTomeandPrincipe","saudi-arabia":"SaudiArabia","se":"Se","scarves":"Scarves","search":"Search","select-a-size":"Selectasize","senegal":"Senegal","sensor-size-1080p-no-card-plug-type-eu-plug":"SensorSize:1080PNoCard/PlugType:EUplug","sensor-size-5mp-ptz-camera-plug-type-eu-plug":"SensorSize:5MPPTZCamera/PlugType:EUplug","serbia":"Serbia","settings":"Settings","seychelles":"Seychelles","sherpa-fleece-blanket-50-x-60-":"SherpaFleeceBlanket-50\"x60\"","sherpa-fleece-blanket-60-x-80-":"SherpaFleeceBlanket-60\"x80\"","sherpafleeceblanket50x60":"SherpaFleeceBlanket50x60","sherpafleeceblanket60x80":"SherpaFleeceBlanket60x80","ship":"ship","shipping-options.order-estimated-to-deliver-on-rush":"Deliversby{rushShipping}","shir":"shir","shirtts=":"shirtts=","shoe":"shoe","shoes":"Shoes","shop-now":"ShopNow","shopper-sign-up":"ShopperSignUp","short-length-socks":"ShortLengthSocks","shortlengthsocks":"ShortLengthSocks","show-more-offers":"ShowMoreOffers","shower-curtain":"ShowerCurtain","shower-curtains":"ShowerCurtains","showercurtain":"ShowerCurtain","showercurtains":"ShowerCurtains","shuangshuo-new-arrival-chihuahua-stainless-steel-earrings-for-dog-studs-chihuahua-jewelry-love-my-pet-animal-earrings":"ShuangshuoNewArrivalChihuahuaStainlessSteelEarringsforDogStudsChihuahuaJewelryLoveMyPetAnimalEarrings","side":"Side","sierra-leone":"SierraLeone","sign-in":"Signin","sign-up":"SignUp","singapore":"Singapore","single-color":"Singlecolor","sint-maarten":"SintMaarten","size":"Size","size-10cm-animal-plush-stuffed-toys":"Size10CMAnimalPlushStuffedToys","size-150x130-cm-color-gt625-19":"Size:150X130CM/Color:gt625-19","sk-super-slim-sliver-mesh-stainless-stee-women-top-brand-luxury-casual-clock-ladies-wrist-watch-lady-relogio-feminino":"SKSuperSlimSliverMeshStainlessSteeWomenTopBrandLuxuryCasualClockLadiesWristWatchLadyRelogioFeminino","sl-maner.maner-threshold-coupon-form.threshold-banner":"\u003cstrong>Freeshipping\u003c/strong>foranyordersabove{thresholdValue}","sl-maner.maner-threshold-coupon-form.threshold-banner-free":"\u003cstrong>Freeshipping\u003c/strong>forallorders","sl-retail.are-you-sure":"AreYouSure?","sl-retail.bundle-removal-modal-legend":"Removingthisitemwillremovethediscountontheotherapplicableitemsinyourcart.Areyousureyouwanttoproceed?","sl-retail.bundles.add-both-to-cart":"AddBothtoCart","sl-retail.bundles.added-to-cart":"Addedtocart","sl-retail.bundles.bundle-and-se":"BundleandSe","sl-retail.bundles.frequently-bought-together":"FrequentlyBoughtTogether","sl-retail.bundles.total-price":"TotalPrice","sl-retail.buy.free-shipping":"FreeShipping","sl-retail.buy.free-shipping-on-your-order.on-your-order":"OnYourOrder","sl-retail.buy.off-your-purchase.off":"Off","sl-retail.buy.off-your-purchase.this-collection":"Anyiteminthiscollection","sl-retail.buy.off-your-purchase.your-purchase":"YourItem","sl-retail.buyer-account.my-account.spin-to-win-button":"Spin","sl-retail.buyer-account.my-account.spin-to-win-section-title":"DailySpinandWin","sl-retail.buyer-account.my-account.spin-to-win-title":"DailySpinandWin","sl-retail.buyer-account.post-account-creation-card-body":"Youwillbeabletoaccessyouraccountsettingsthroughtheprofilepe.","sl-retail.buyer-account.post-account-creation-card-header":"Thankyouforcreatinganaccount!","sl-retail.buyer-account.signup-cta":"ContinueWithEmail","sl-retail.buyer-account.terms-and-privacy":"{terms}and{privacy}","sl-retail.buyer-account.terms-and-privacy-preface":"Bycreatinganaccount,youreeto{groupName}'s","sl-retail.campaign-buy.add-another-style-or-color":"Addanotherstyleorcolor","sl-retail.campaign-buy.add-another-style-or-color-mobile":"Addstyleorcolor","sl-retail.campaign-buy.add-to-cart":"Addtocart","sl-retail.campaign-buy.add-upsell-item":"Add","sl-retail.campaign-buy.all-products-printed-in-us":"Allproductsaremade-to-orderandproudlyprintedintheUnitedStates.","sl-retail.campaign-buy.ailable-colors":"Colors","sl-retail.campaign-buy.ailable-products":"ailableproducts","sl-retail.campaign-buy.buy-it-now":"Buyitnow","sl-retail.campaign-buy.campaign-details":"Campaigndetails","sl-retail.campaign-buy.campaign-keywords-and-ts":"Keywords&Ts","sl-retail.campaign-buy.campaign-ts":"Ts","sl-retail.campaign-buy.checkout-with-paypal":"CheckoutwithPaypal","sl-retail.campaign-buy.color":"Color:","sl-retail.campaign-buy.color-out-of-stock":"Coloroutofstock","sl-retail.campaign-buy.congrats-coupon-free-shipping":"Congrats!Youqualifyforfreeshippingonyourorder!","sl-retail.campaign-buy.congrats-coupon-off":"Congrats!Youqualifyfor{amount}offyouritem!","sl-retail.campaign-buy.covid-delivery-time":"Shipmentswilldeliverin10to20businessdays.","sl-retail.campaign-buy.customers-love":"Ourcustomersloveus!","sl-retail.campaign-buy.description":"description","sl-retail.campaign-buy.discount-automatically-added-at-checkout":"Discountautomaticallyaddedatcheckout.","sl-retail.campaign-buy.estimated-to-arrive":"Estimatedtoarrivein5to10days","sl-retail.campaign-buy.from-storefront":"From","sl-retail.campaign-buy.gift-recipient-title":"Whoisthisgiftfor?","sl-retail.campaign-buy.keywords-title":"Keywords:","sl-retail.campaign-buy.last-day-to-order":"Lastdaytoorder!","sl-retail.campaign-buy.made-info":"Allproductsaremadetoorderandprintedtothebeststandardsailable.Theydonotincludeembellishments,suchasrhinestones","sl-retail.campaign-buy.minutes-left-to-buy":"lefttobuy","sl-retail.campaign-buy.off-your-purchase-applied-at-checkout":"{amount}offyourpuchase.","sl-retail.campaign-buy.orders-are-expected-to-arrive":"Ordersareexpectedtoarrivewithin5to10businessdays.","sl-retail.campaign-buy.orders-are-expected-to-arrive-within":"Orderswillshipbetween{earliest}and{latest}.","sl-retail.campaign-buy.out-of-stock":"OutofStock","sl-retail.campaign-buy.people-also-bought":"Peoplealsobought","sl-retail.campaign-buy.product-details":"Productdetails","sl-retail.campaign-buy.product-reviews":"productreviews","sl-retail.campaign-buy.quantity":"Qty:","sl-retail.campaign-buy.redeem-offer":"Redeemoffer","sl-retail.campaign-buy.report-this-campaign":"Reportthiscampaign","sl-retail.campaign-buy.review-order":"ReviewOrder","sl-retail.campaign-buy.rush-shipping":"Rushshipping(3-DayAir)isailableforanadditional{cost}fee","sl-retail.campaign-buy.rush-shipping-ailable":"Rush3-dayserviceisailableonselectproducts.","sl-retail.campaign-buy.rush-shipping-international":"Rushshippingisnotailableforinternational","sl-retail.campaign-buy.select-size-messe":"SelectaSize","sl-retail.campaign-buy.selected-color":"{selectedColor}","sl-retail.campaign-buy.selected-size":"{quantity}","sl-retail.campaign-buy.share":"Share","sl-retail.campaign-buy.share-campaign":"Sharecampaign","sl-retail.campaign-buy.shipping-cost-info":"Shippingfor{product}is{firstPrice}forthefirstitemand{additionalPrice}foreachadditionalitem","sl-retail.campaign-buy.shipping-details":"Shippingdetails","sl-retail.campaign-buy.shipping-info":"Shippinginfo","sl-retail.campaign-buy.shipping-info-link":"Formoredetailsaboutourshippingrates,pleasevisit","sl-retail.campaign-buy.shipping-info-link-here":"here","sl-retail.campaign-buy.shipping-returns-info-link-head":"Learnmoreaboutourshippingrates","sl-retail.campaign-buy.shipping-returns-info-link-tail":"andourreturnsandexchangespolicy","sl-retail.campaign-buy.shipping-returns-refunds-info-link-tail":"andourreturns,refunds,andexchangespolicy","sl-retail.campaign-buy.shipping-times-vary-international-orders":"Shippingtimeswillvaryforinternationalorders","sl-retail.campaign-buy.size":"Size:","sl-retail.campaign-buy.size-guide":"Sizeguide","sl-retail.campaign-buy.size-guide.youth-size":"Youthsize","sl-retail.campaign-buy.size-out-of-stock":"Sizeoutofstock","sl-retail.campaign-buy.skip-to-checkout":"Skiptocheckout","sl-retail.campaign-buy.sold-count":"Sold","sl-retail.campaign-buy.ts-subtitle":"Ts:","sl-retail.campaign-buy.tweet":"Tweet","sl-retail.campaign-buy.view-cart":"Viewcart","sl-retail.campaign-buy.your-order":"YourOrder","sl-retail.cart.more-from":"MoreFrom","sl-retail.cart.more-related-to":"MoreRelatedTo","sl-retail.cart.no-items-in-cart":"Noitemsincart","sl-retail.cart.number-items":"{itemCount}{itemCount,plural,one{item}other{items}}","sl-retail.cart.proceed-to-checkout":"Proceedtocheckout","sl-retail.cart.shipping-and-tax-on-checkout":"Shippingandtaxcalculatedoncheckout","sl-retail.cart.showing-number-items":"Showing{itemCount}{itemCount,plural,one{item}other{items}}","sl-retail.cart.your-cart":"YourCart","sl-retail.cash-modal.terms-and-privacy":"Readour{terms}formoreinformation.","sl-retail.cash-reward-signup.terms-and-privacy":"Bysigningupyoureetoour{terms}&{privacy}","sl-retail.catalog.apply-filters":"ApplyFilters","sl-retail.catalog.category":"Category","sl-retail.catalog.clear-all-filters":"Clearall","sl-retail.catalog.department":"Department","sl-retail.catalog.few-left":"Fewleft","sl-retail.catalog.filter-products":"Filterproducts","sl-retail.catalog.hot-item":"Hot","sl-retail.catalog.no-filters-found":"Nofiltersfound","sl-retail.catalog.no-products-found":"Noproductsfound.","sl-retail.catalog.please-remove-some-filters-and-try-ain":"Pleaseremovesomefiltersandtryain.","sl-retail.catalog.sort-by":"Sortby:","sl-retail.catalog.sort-latest-first":"Newest","sl-retail.catalog.sort-oldest-first":"Oldest","sl-retail.catalog.sort-price-highest-first":"Price:HighestFirst","sl-retail.catalog.sort-price-lowest-first":"Price:LowestFirst","sl-retail.catalog.sort-top-selling":"TopSelling","sl-retail.checkout.billing-address-same-as-shipping-address":"Sameasshippingaddress","sl-retail.checkout.by-placing-order":"Byplacingyourorder,youreetoour","sl-retail.checkout.card":"Card","sl-retail.checkout.card-number":"Debitorcreditcardnumber","sl-retail.checkout.change-payment-method":"Changepaymentmethod","sl-retail.checkout.checking-out-with-paypal":"RedirectingtoPayPal","sl-retail.checkout.checkout":"Checkout","sl-retail.checkout.confirm-address-messe":"Wehadtroubleverifyingtheaddressyouentered.Pleasemakesureit’scorrect.","sl-retail.checkout.content_error":"Yourcartcontenthasbeenchanged,pleasecheckoutain.","sl-retail.checkout.continue-with-paypal":"Continuewith","sl-retail.checkout.credit-card":"CreditCard","sl-retail.checkout.cvv":"CVV","sl-retail.checkout.donation-covid-19-relief":"COVID-19Relief","sl-retail.checkout.donation-round-up-covid":"Roundupfor","sl-retail.checkout.empty-cart":"Noitemsinyourcart","sl-retail.checkout.eu_extra_charges_messe":"YoumayhetopayimportVAT(andcustomsduties,ifpayable)andahandlingfee.Thesechargeswilldependonthecountry,andthevalueoftheitem.","sl-retail.checkout.euro-shipping-delay-messe":"ExpectprocessingdelaysforGiropayandSofortpayments","sl-retail.checkout.finalize-order":"FinalizeOrder","sl-retail.checkout.incorrect_cvc":"Thecard'ssecuritycodeisincorrect.","sl-retail.checkout.invalid-card":"Invalidcard.Pleasecheckinputdetailsortryadifferentmethod.","sl-retail.checkout.invalid_email":"Emailaddressmissingorinvalid","sl-retail.checkout.invalid_expiry":"Invalidcardexpirationdate","sl-retail.checkout.invalid_number":"Thecardnumberisnotavalidcreditcardnumber.","sl-retail.checkout.item-shipping-unailable":"Productdoesn'tshiptoyourlocation","sl-retail.checkout.local-shipping-notice":"Wearesorry,butwearenotabletoshipsomeproductstothecountryyouselected,{country}.","sl-retail.checkout.order-estimated-to-ship-on":"Orderestimatedtoshipon","sl-retail.checkout.order-price-changed":"Yourorderpricehaschanged.Pleasetryplacingyourorderain.Youhenotbeencharged.","sl-retail.checkout.payment-info":"Paymentinfo","sl-retail.checkout.paypal-setup-error":"Wecouldn'tcompleteyourPayPalpayment.Pleasetryacreditcardorretryyourpayment.","sl-retail.checkout.placing":"PlacingYourOrder...","sl-retail.checkout.processing_error":"Cannotprocesspayment,pleasetryainlater","sl-retail.checkout.promo-contact-option":"Iwouldliketoreceiveemails/SMSaboutnewproductsdirectlyfromthesesellersoranylicensedpartners","sl-retail.checkout.promo-email-option":"Iwouldliketoreceiveemailsaboutnewproductsdirectlyfromthesesellersoranylicensedpartners","sl-retail.checkout.review-order":"ReviewOrder","sl-retail.checkout.sepa":"Paywith{name}","sl-retail.checkout.sepa-mandate":"ByprovidingyourIBANandconfirming\nthispayment,youareauthorizing{groupName}and\nStripe,ourpaymentserviceprovider,tosend\ninstructionstoyourbanktodebityouraccount\ninaccordancewiththoseinstructions.Youareentitled\ntoarefundfromyourbankunderthetermsandconditions\nofyourreementwithyourbank.Arefundmustbe\nclaimedwithin8weeksstartingfromthedateonwhich\nyouraccountwasdebited.","sl-retail.checkout.shipping":"Shipping","sl-retail.checkout.shipping-invalid":"Yourshippingaddressisinvalid","sl-retail.checkout.shipping-missing":"Enterashippingaddress","sl-retail.checkout.submit-order":"PlaceYourOrder","sl-retail.checkout.terms-of-service":"termsofservice","sl-retail.checkout.you-entered":"Youentered:","sl-retail.checkout.your-order-reserved":"Yourorderwillbereservedfor","sl-retail.confirm-duplicate-description":"Youalreadyhe{quantity}ofthisiteminyourcart,wouldyouliketoadd{additional}more?","sl-retail.coupon-notification-modal.congrats-coupon-free-shipping":"Congrats!Youqualifyforfreeshippingonyourorder!","sl-retail.coupon-notification-modal.congrats-coupon-off":"Congrats!Youqualifyfor{amount}offyourpurchase!","sl-retail.coupon-notification-modal.discount-automatically-added-at-checkout":"Discountautomaticallyaddedatcheckout.","sl-retail.coupon-notification-modal.redeem-offer":"Redeemoffer","sl-retail.fathers.more-from":"{title}{interest}","sl-retail.footer.back-to-top":"BackToTop","sl-retail.holiday-modal.orders-ship-between":"Yourorderwillshipbetween{earliest}and{latest}.","sl-retail.holiday-modal.orders-ship-between-regions":"{regions}orderswillshipbetween{earliest}and{latest}.","sl-retail.holiday-modal.orders-ship-between-regions-0":"{regions}orderswillshipbetween{earliest}and{latest}.","sl-retail.holiday-modal.orders-ship-between-regions-1":"{regions}orderswillshipbetween{earliest}and{latest}.","sl-retail.homepe.cat-dog":"AreDogsBetterThanCats?","sl-retail.homepe.cat-yes":"NoWay!","sl-retail.homepe.dog-yes":"OfCourse!","sl-retail.homepe.featured-categories":"FeaturedCategory","sl-retail.homepe.its-a-name-thing":"It'sa{name}Thing","sl-retail.homepe.people-also-bought":"PeopleAlsoBought","sl-retail.homepe.recommended-for-you":"RecommendedForYou","sl-retail.homepe.related-products":"Relatedproducts","sl-retail.keep-my-items":"KeepMyItems","sl-retail.landing.shop-by-collection":"Shopbycollection","sl-retail.mobilen.all":"All","sl-retail.order-description.delivered":"Yourorderwasdelivered.Makesuretocheckyourmailbox!","sl-retail.order-description.no-cancellation":"Yourorderhasbeenpreparedforprocessingandcannolongerbemodifiedorcanceled.","sl-retail.order-description.pending":"EUpaymentmethodssuchasGiropayandSofortarelikelytoexperienceadelay.Wewillproceedwithyourorderassoonasthepaymenthasbeenreceived.Thankyouforshoppingwithus.","sl-retail.order-description.processing":"Weareprocessingyourorder.Yourorderwillshipbetween{start}and{end}.","sl-retail.order-description.received":"Thanksforplacingyourorderwithus.Yourorderwillbeprocessedshortly.","sl-retail.order-description.refunded":"Wearesorrythatyouheproblemwithourproduct,arefundhasbeenissuedtotheorder","sl-retail.order-description.rushProcessingPlural":"Withrushshipping,yourorderwillshipasearlyas{day}.","sl-retail.order-description.rushValidated":"Weareprocessingyourorder.Yourorderwillshipasearlyas{day}.","sl-retail.order-description.shipped":"Yourorderisonitsway!Checkoutthetrackinginformationbelow:","sl-retail.order-description.validated":"Weareprocessingyourorder.Yourorderwillshipbetween{start}and{end}.","sl-retail.order-status.card-ending-in-xxxx":"endingin","sl-retail.order-status.delivered":"Yourorderhasbeendelivered!","sl-retail.order-status.order-detail":"Orderdetail","sl-retail.order-status.order-history":"Orderhistory","sl-retail.order-status.paypal-account":"PayPalaccount","sl-retail.order-status.processing":"Weareprocessingyourorder!","sl-retail.order-status.received":"We'vereceivedyourorder!","sl-retail.order-status.refunded":"We'verefundedyourorder","sl-retail.order-status.rushValidated":"Weareprocessingyourorder!","sl-retail.order-status.shipped":"Yourorderhasshipped!","sl-retail.order-status.shipped-to":"Shippedto","sl-retail.order-status.shipping-to":"Shippingto","sl-retail.order.missing-number":"Idonotknowmyordernumber","sl-retail.post-checkout-reward.slx-gamification-check-prize":"ClaimYourPrize!","sl-retail.post-checkout-reward.slx-gamification-question-mark":"$??","sl-retail.post-checkout-reward.slx-gamification-spin":"Spin","sl-retail.post-checkout-reward.slx-gamification-title":"Winupto$50OffYourNextOrder","sl-retail.post-checkout-sign-up.create-account":"CreateanAccount","sl-retail.post-checkout-sign-up.make-experience":"Makeyourshoppingexperienceabreeze,createanaccounttoday!","sl-retail.privacy":"PrivacyPolicy","sl-retail.product-grouped.-_0":"!`=[]'/.,;_0","sl-retail.product-grouped.12-constellation-luminous-keychain-glass-ball-pendant-zodiac-keychain":"12ConstellationLuminousKeychainGlassBallPendantZodiacKeychain","sl-retail.product-grouped.16oz-pint-glass":"16ozPintGlass","sl-retail.product-grouped.16oz-pint-glass-2-pieces":"16ozPintGlass-2pieces","sl-retail.product-grouped.20oz-tumbler":"20ozTumbler","sl-retail.product-grouped.3d-hair-halloween-accesories":"3DHairHalloweenAccessories","sl-retail.product-grouped.a-group-name":"agroupname","sl-retail.product-grouped.accessory-pouch":"AccessoryPouch","sl-retail.product-grouped.alien-inflatable-costume":"AlienInflatableCostume","sl-retail.product-grouped.aluminum-welding-rods":"AluminumWeldingRods","sl-retail.product-grouped.area-rugs":"AreaRugs","sl-retail.product-grouped.bath-mat":"BathMat","sl-retail.product-grouped.bell-ornament":"bellornament","sl-retail.product-grouped.black-floating-framed-canvas-wrap-print":"FloatingFramedCanvasPrintsBlack","sl-retail.product-grouped.black-hanging-canvas-print":"HangingCanvas","sl-retail.product-grouped.booty-lifting-anti-cellulite-leggings":"BootyLiftingAnti-CelluliteLeggings","sl-retail.product-grouped.briefs":"Briefs","sl-retail.product-grouped.brush":"Brush","sl-retail.product-grouped.bumper-sticker":"BumperSticker","sl-retail.product-grouped.canvas-wrap-print":"GalleryWrappedCanvasPrints","sl-retail.product-grouped.charlie-test":"CharlieTest","sl-retail.product-grouped.circle-ornament-porcelain":"CircleOrnament(Porcelain)","sl-retail.product-grouped.circle-ornament-wood":"CircleOrnament(Wood","sl-retail.product-grouped.clock":"Clock","sl-retail.product-grouped.coffee-makers":"coffeemakers","sl-retail.product-grouped.comforter":"Comforter","sl-retail.product-grouped.coral-fleece-blanket":"FleeceBlanket","sl-retail.product-grouped.cross-border-new-classic-plaid-pet-saliva-towel":"Cross-bordernewclassicplaidpetsalivatowel","sl-retail.product-grouped.doormat":"Doormat","sl-retail.product-grouped.double-sided-nano-mic-tape":"20mmDouble-SidedMulti-FunctionWashableTape(TCD-333)","sl-retail.product-grouped.duvet-cover":"DuvetCover","sl-retail.product-grouped.easel-back-canvas-print":"Easel-BackGalleryWrappedCanvas","sl-retail.product-grouped.face-mask":"Mask","sl-retail.product-grouped.fancy-shirt":"Fancyshirt","sl-retail.product-grouped.fancy-tshirts":"fancytshirts","sl-retail.product-grouped.fls":"Fls","sl-retail.product-grouped.fleece-scarf":"FleeceScarf","sl-retail.product-grouped.floor-path-mold":"FloorPathMold","sl-retail.product-grouped.glitter-tumbler":"GlitterTumbler","sl-retail.product-grouped.groupby":"GroupBy","sl-retail.product-grouped.heart-ornament-porcelain":"HeartOrnament(Porcelain)","sl-retail.product-grouped.heart-ornament-wood":"HeartOrnament(Wood)","sl-retail.product-grouped.home-mop-with-bucket":"HomeMopwithBucketand4MopPads","sl-retail.product-grouped.hooded-blanket":"HoodedBlankets","sl-retail.product-grouped.hooded-blankets":"HoodedBlankets","sl-retail.product-grouped.husky":"Husky","sl-retail.product-grouped.indoor-pillow":"IndoorPillow","sl-retail.product-grouped.inflatable-trex-costume":"InflatableT-RexCostume","sl-retail.product-grouped.inkblot-mask":"InkblotMask","sl-retail.product-grouped.laundry-baskets":"LaundryBaskets","sl-retail.product-grouped.lugge-cover":"LuggeCover","sl-retail.product-grouped.mic-fishing-net":"MicFishingNet","sl-retail.product-grouped.makeup":"makeup","sl-retail.product-grouped.makeup-brush-set":"sl-retail.product-grouped.makeup-brush-set","sl-retail.product-grouped.marshmallow-cat-bed":"MarshmallowCatBed","sl-retail.product-grouped.masks":"Masks","sl-retail.product-grouped.men-s-aop-t-shirt":"Men'sAOPT-Shirt","sl-retail.product-grouped.mighty-power-hose-nozzle":"MightyPowerHoseNozzle","sl-retail.product-grouped.mug":"Mug","sl-retail.product-grouped.mugs":"Mugs","sl-retail.product-grouped.my-husky":"MyHusky","sl-retail.product-grouped.neck-gaiter":"NeckGaiter","sl-retail.product-grouped.ninja-disguise-inside-out-t-shirt":"NINJADISGUISEinsideoutt-shirt","sl-retail.product-grouped.notebooks":"Notebooks","sl-retail.product-grouped.oval-ornament":"ovalornament","sl-retail.product-grouped.panties":"Panties","sl-retail.product-grouped.pepe":"Pepe","sl-retail.product-grouped.pet-bed":"PetBed","sl-retail.product-grouped.pillow-sham":"PillowSham","sl-retail.product-grouped.pillows-bedding":"Pillows&Bedding","sl-retail.product-grouped.pint-glass":"PintGlass","sl-retail.product-grouped.pocket-pullover-sweater":"Pocketpulloversweater","sl-retail.product-grouped.poster-landscape":"HorizontalPoster","sl-retail.product-grouped.poster-standard":"VerticalPoster","sl-retail.product-grouped.prank":"Prank","sl-retail.product-grouped.prank-spider":"PrankSpider","sl-retail.product-grouped.prank-spider-spider":"PrankSpider-Spider","sl-retail.product-grouped.print-glass":"PrintGlass","sl-retail.product-grouped.puzzles":"Puzzles","sl-retail.product-grouped.quilt":"Quilt","sl-retail.product-grouped.quilt-bed-set":"QuiltBedSet","sl-retail.product-grouped.sherpa-fleece-blanket":"SherpaFleeceBlanket","sl-retail.product-grouped.sleeve-blanket":"SleeveBlankets","sl-retail.product-grouped.sleeve-blankets":"SleeveBlankets","sl-retail.product-grouped.snowflake-ornament":"snowflakeornament","sl-retail.product-grouped.spookymasks":"spookymasks","sl-retail.product-grouped.star-ornament-porcelain":"StarOrnament(Porcelain)","sl-retail.product-grouped.star-ornament-wood":"StarOrnament(Wood)","sl-retail.product-grouped.stars":"stars","sl-retail.product-grouped.stickers":"Sticker","sl-retail.product-grouped.table-runner":"TableRunner","sl-retail.product-grouped.toys2":"Toys2","sl-retail.product-grouped.toys3":"Toys3","sl-retail.product-grouped.toys4":"Toys4","sl-retail.product-grouped.toys5":"Toys5","sl-retail.product-grouped.tree-ornament":"treeornament","sl-retail.product-grouped.very-nice-tshirts":"verynicetshirts","sl-retail.product-grouped.wall-tapestry":"WallTapestry","sl-retail.product-grouped.white-floating-framed-canvas-wrap-print":"FloatingFramedCanvasPrintsWhite","sl-retail.product-grouped.window-curtain":"WindowCurtain","sl-retail.product-grouped.women-s-aop-t-shirt":"Women'sAOPT-Shirt","sl-retail.product-grouped.women-s-racerback-tank-dress":"Women'sRacerbackTankDress","sl-retail.product-grouped.women-s-racerback-tanktop":"Women'sRacerbackTanktop","sl-retail.product-grouped.womens-clutch-purse":"WomensClutchPurse","sl-retail.product-grouped.womens-leather-wallet":"WomensLeatherWallet","sl-retail.product-grouped.wooden-prints":"WoodenPrints","sl-retail.product-grouped.woven-rugs":"WovenRug","sl-retail.product-grouped.yard-sign":"YardSigns","sl-retail.product-grouped.yoga-mat":"YogaMats","sl-retail.product.description.-erfghj_":"!*-erfghJ_:","sl-retail.product.description.-2-86-x-2-86":"~2.86\"x2.86\"","sl-retail.product.description.-able-to-be-tucked-away-in-store-until-the-next-year":"-Abletobetuckedawayinstoreuntilthenextyear.","sl-retail.product.description.-art-is-printed-directly-onto-the-board-with-eco-friendly-zero-voc-ink":"-ArtisprinteddirectlyontotheboardwithEco-friendlyZeroVOCInk","sl-retail.product.description.-artwork-is-printed-directly-onto-the-board-using-eco-friendly-zero-voc-ink-a":"-ArtworkisprinteddirectlyontotheboardusingEco-friendlyZeroVOCInka","sl-retail.product.description.-artwork-is-printed-directly-onto-the-wood-using-eco-friendly-zero-voc-ink":"-ArtworkisprinteddirectlyontothewoodusingEco-friendlyZeroVOCInk","sl-retail.product.description.-built-in-sawtooth-hangers-for-easy-application-and-alignment-on-walls":"-Built-insawtoothhangersforeasyapplicationandalignmentonwalls","sl-retail.product.description.-built-in-sawtooth-hangers-for-easy-wall-application-and-alignment":"-Built-insawtoothhangersforeasywallapplicationandalignment","sl-retail.product.description.-crafted-in-the-u-s-with-high-quality-north-american-pine-wood":"-CraftedintheU.S.withhigh-qualityNorthAmericanPineWood","sl-retail.product.description.-design-is-printed-directly-onto-the-board-using-eco-friendly-zero-voc-ink":"-DesignisprinteddirectlyontotheboardusingEco-friendlyZeroVOCInk","sl-retail.product.description.-easy-to-tuck-away-in-store-for-next-year":"-Easytotuckawayinstorefornextyear.","sl-retail.product.description.-eco-friendly-zero-voc-ink-is-used-to-print-artwork-directly-onto-the-board":"-Eco-friendlyZeroVOCInkisusedtoprintartworkdirectlyontotheboard","sl-retail.product.description.-every-item-is-made-to-order":"-Everyitemismade-to-order","sl-retail.product.description.-every-item-is-made-to-order-after-purchase":"-Everyitemismade-to-orderafterpurchase","sl-retail.product.description.-every-order-is-made-after-the-purchase":"-Everyorderismadeafterthepurchase","sl-retail.product.description.-every-order-is-produced-individually-after-the-purchase":"-Everyorderisproducedindividuallyafterthepurchase","sl-retail.product.description.-every-wooden-print-is-made-to-order":"-Everywoodenprintismade-to-order","sl-retail.product.description.-every-wooden-print-is-produced-individually-after-the-purchase":"-Everywoodenprintisproducedindividuallyafterthepurchase","sl-retail.product.description.-expanded-size-9-45-w-x-3-62-h-folded-size-4-72-w-x-3-62-h-weight-2-68-oz":"-Expandedsize:9.45\"(W)x3.62\"(H).Foldedsize:4.72\"(W)x3.62\"(H).Weight:2.68oz.","sl-retail.product.description.-hello-commas":",hello,commas","sl-retail.product.description.-includes-built-in-sawtooth-hangers-for-easy-wall-application-and-alignment":"-Includesbuilt-insawtoothhangersforeasywallapplicationandalignment","sl-retail.product.description.-includes-sawtooth-hangers-for-easy-wall-application-and-alignment":"-Includessawtoothhangersforeasywallapplicationandalignment","sl-retail.product.description.-inside-contents-not-included":"insidecontentsnotincluded","sl-retail.product.description.-made-in-the-u-s-with-high-quality-north-american-pine-wood":"-MadeintheU.S.withhigh-qualityNorthAmericanPineWood","sl-retail.product.description.-made-in-the-u-s-with-north-american-pine-wood":"-MadeintheU.S.withNorthAmericanPineWood","sl-retail.product.description.-made-using-north-american-pine-wood-in-the-u-s":"-MadeusingNorthAmericanPineWoodintheU.S.","sl-retail.product.description.-material-porcelain":"-Material:porcelain","sl-retail.product.description.-one-quilt-size-details-with-a-luxurious-diamond-stitched-pattern-brings-beauty-and-elegance-to-the-bedroom":"-Onequilt(sizedetails)withaluxuriousdiamondstitchedpatternbringsbeautyandelegancetothebedroom","sl-retail.product.description.-perfect-for-hanging-on-the-christmas-tree-as-they-don-t-weigh-it-down":"-PerfectforhangingontheChristmastree,astheydon’tweighitdown.","sl-retail.product.description.-perfect-size-2-8-x-2-7":"-Perfectsize:~2.8\"x2.7\"","sl-retail.product.description.-plant":"plant","sl-retail.product.description.-printed-on-both-sides":"-Printedonbothsides","sl-retail.product.description.-printed-on-both-sides-which-makes-them-look-awesome-from-any-angle":"-Printedonbothsides,whichmakesthemlookawesomefromanyangle.","sl-retail.product.description.-proudly-made-in-the-u-s-with-high-quality-north-american-pine-wood":"-ProudlymadeintheU.S.withhigh-qualityNorthAmericanPineWood","sl-retail.product.description.-proudly-made-in-the-u-s-with-north-american-pine-wood":"-ProudlymadeintheU.S.withNorthAmericanPineWood","sl-retail.product.description.-ready-to-hang-on-your-tree-wreath-or-doorway-as-it-comes-with-an-attached-loop":"-Readytohangonyourtree,wreath,ordoorway,asitcomeswithanattachedloop.","sl-retail.product.description.-sawtooth-hangers-are-already-built-in-for-easy-wall-application-and-alignment":"-Sawtoothhangersarealreadybuilt-inforeasywallapplicationandalignment","sl-retail.product.description.-sawtooth-hangers-are-already-built-in-for-easy-wall-hanging-and-alignment":"-Sawtoothhangersarealreadybuilt-inforeasywallhangingandalignment","sl-retail.product.description.-second-description":"seconddescription","sl-retail.product.description.-shape-bell":"-Shape:Bell","sl-retail.product.description.-two-pillow-covers-with-matching-one-sided-printing-and-seamless-dual-flap-closure-pillow-inserts-not-included":"-Twopillowcoverswithmatchingone-sidedprintingandseamlessdualflapclosure.PillowinsertsNOTincluded","sl-retail.product.description.0-25-slim-making-it-just-the-right-size-for-every-entryway-our-unique-doormats-make-a-beautiful-addition-to-your-entryways-craft-rooms-and-office-spaces":"0.25\"slim,makingitjusttherightsizeforeveryentryway.Ouruniquedoormatsmakeabeautifuladditiontoyourentryways,craftrooms,andofficespaces.","sl-retail.product.description.0-25-slim-making-it-just-the-right-size-for-every-entryway-our-unique-doormats-make-a-beautiful-addition-to-your-entryways-craft-rooms-and-office-spaces-printed-in-the-usa-this-mat-is-safe-for-indoor-or-outdoor-use-backed-with-non-slip-material-and-topped-with-polyester-felt-that-is-low-profile-to-reduce-chances-of-tripping-mats-can-be-highly-effective-in-trapping-dirt-before-entering-the-house-and-reducing-the-amount-of-dust-and-dirt-that-comes-into-the-building-perfect-for-any-deck-patio-porch-veranda-and-entryway-and-extend-a-warm-welcome-to-all-who-enter-your-home":"0.25\"slim,makingitjusttherightsizeforeveryentryway.Ouruniquedoormatsmakeabeautifuladditiontoyourentryways,craftrooms,andofficespaces.\nPrintedintheUSA\nThismatissafeforindoororoutdooruse\nBackedwithnon-slipmaterialandtoppedwithpolyesterfeltthatislow-profiletoreducechancesoftripping.\nMatscanbehighlyeffectiveintrappingdirtbeforeenteringthehouseandreducingtheamountofdustanddirtthatcomesintothebuilding.\nPerfectforanydeck,patio,porch,veranda,andentrywayandextendawarmwelcometoallwhoenteryourhome!","sl-retail.product.description.0.75.inches.thickness":"0.75\"Thickness","sl-retail.product.description.1-press-the-button-to-turn-the-cob-light-on-the-upper-panel":"1.PressthebuttontoturntheCOBlightontheupperpanel","sl-retail.product.description.10.oz.100.cotton.canvas":"10oz.,100%cottoncanvas","sl-retail.product.description.100":"100","sl-retail.product.description.100-cotton-yarn-and-a-colorful-fringe-that-frames-your-ime":"100%cottonyarnandacolorfulfringethatframesyourime","sl-retail.product.description.100-microfiber-poly-velour-front-100-cotton-back":"100%microfiberpolyvelourfront/100%cottonback","sl-retail.product.description.100-organic-cotton":"100%organiccotton","sl-retail.product.description.100-polyester":"100%polyester","sl-retail.product.description.100-polyester-chenille":"100%PolyesterChenille","sl-retail.product.description.100-polyester-single-layer-1-ply":"Durablepolyesterclothfacecovering","sl-retail.product.description.100-polyester-with-soft-to-the-touch-feel":"100%polyester","sl-retail.product.description.100-rubber-with-anti-slip-tread":"100%rubberwithanti-sliptread","sl-retail.product.description.100-spun-polyester":"100%spunpolyester","sl-retail.product.description.100-spun-polyester-stuffing-not-included":"100%spunpolyester(stuffingnotincluded)","sl-retail.product.description.100.acrylic":"100%acrylic","sl-retail.product.description.100.coral.fleece.polyester":"100%Coralfleecepolyester","sl-retail.product.description.100.cotton.twill":"100%cottontwill","sl-retail.product.description.100.polycarbonate":"100%Polycarbonate","sl-retail.product.description.100.polyester.front.and.back":"100%polyester(frontandback)","sl-retail.product.description.100.polyester.twill":"100%PolyesterTwill","sl-retail.product.description.100.polyester.twill.wee":"100%polyester,twillwee","sl-retail.product.description.100.polyester.water.resistant.shell":"100%polyester,water-resistantshell","sl-retail.product.description.100.polyester.with.honeycomb.texture":"100%polyesterwithhoneycombtexture","sl-retail.product.description.100.polyester.with.reinforced.seams":"100%polyesterwithreinforcedseams","sl-retail.product.description.100.soft.spun.polyester":"100%soft,spunpolyester","sl-retail.product.description.100.textured.woven.polyester":"100%textured,wovenpolyester","sl-retail.product.description.11-inch-leg-length-28cm":"11-inchleglength(28cm)","sl-retail.product.description.12-oz-stemless-wine-tumbler":"12ozstemlesswinetumbler","sl-retail.product.description.12.button.holes.for.hook.placements":"12Buttonholesforhookplacements","sl-retail.product.description.15pcs-brush-set":"15pcsBrushSet","sl-retail.product.description.16-9-oz-double-wall-vacuum-insulated-powder-coated-bottle":"16.9ozdoublewallvacuuminsulatedpowdercoatedbottle","sl-retail.product.description.2-pc-set-with-back-support-and-seat":"2pcsetwithbacksupportandseatcushion","sl-retail.product.description.2-press-the-button-a-second-time-to-turn-the-led-light-on-the-lower-panel":"2.PressthebuttonasecondtimetoturntheLEDlightonthelowerpanel","sl-retail.product.description.2.inches.flanges":"2\"flanges","sl-retail.product.description.24-oz-700-ml-durable-single-wall-co-polyester-water-bottle-with-cob-led-lights-in-lid":"24oz.(700mL)durablesingle-wallCo-PolyesterwaterbottlewithCOB&LEDlightsinlid","sl-retail.product.description.27.ropes.handles.fed.through.metal.grommets":"27\"ropehandlesfedthroughmetalgrommets","sl-retail.product.description.3-5-inch-leg-length-9cm":"3.5-inchleglength(9cm)","sl-retail.product.description.3-5in-diameter-circle-8-9cm":"3.5indiametercircle(8.9cm)","sl-retail.product.description.3-led-touch-to-turn-on-light":"3LEDTouchtoturnonlight","sl-retail.product.description.3-pieces":"3pieces","sl-retail.product.description.3.inch.folded.cuff":"3-inchfoldedcuff","sl-retail.product.description.38-pes":"38pes","sl-retail.product.description.4-3in-diameter-circle-11cm":"4.3indiametercircle(11cm)","sl-retail.product.description.4.inches.rod.pocket.with.hemmed.edges":"4”rodpocketwithhemmededges","sl-retail.product.description.5-megapixel-camera-and-led-lights-for-clear-visualization-of-skin":"5megapixelcameraandLEDlightsforclearvisualizationofskin","sl-retail.product.description.5-panel":"5-panel","sl-retail.product.description.50.50.cotton.polyester.blend":"50/50cotton/polyesterblend","sl-retail.product.description.55.45.cotton.polyester.blend":"55/45cotton/polyesterblend","sl-retail.product.description.6-color-inkjet-printing-on-high-quality-canvas-for-a-rich-and-vibrant-print":"6-colorinkjetprintingonhigh-qualitycanvasforarichandvibrantprint","sl-retail.product.description.6-different-suction-heads-for-specialized-needs":"6differentsuctionheadsforspecializedneeds","sl-retail.product.description.6-panel.unstructured":"6-panelunstructured","sl-retail.product.description.6.panel.structured":"6-panelstructured","sl-retail.product.description.7-inch-leg-length-18cm":"7-inchleglength(18cm)","sl-retail.product.description.7in-x-54-5in-18cm-x-138cm":"7inx54.5in(18cmx138cm)","sl-retail.product.description.94-polyester-6-spandex":"94%polyester,6%spandex","sl-retail.product.description.Apply-to-any-hard-smooth-surface-including-paper-plastic-glass-wood-metal":"Applytoanyhardsmoothsurfaceincludingpaper,plastic,glass,wood,metal","sl-retail.product.description.Dishwasher-Safe":"DishwasherSafe","sl-retail.product.description.KissCut-so-sticker-will-be-in-shape-of-artwork":"Kiss-Cutsostickerwillbeinshapeofartwork","sl-retail.product.description.Made-in-USA":"MadeinUSA","sl-retail.product.description.Maximum-size-3-58-x-2-58-with-18-border-around-artwork":"Maximumsize35/8\"x25/8\"with1/8\"borderaroundartwork","sl-retail.product.description.Outdoor-and-Indoor-Use":"OutdoorandIndoorUse","sl-retail.product.description.Removable-Vinyl-Sticker-with-Glossy-Finish":"RemovableVinylStickerwithGlossyFinish","sl-retail.product.description.Water-and-UV-Resistant":"WaterandUVResistant","sl-retail.product.description.a":"a","sl-retail.product.description.a-hanging-loop-on-the-top-of-stocking":"Ahanginglooponthetopofstocking","sl-retail.product.description.a-line-1":"Aline1","sl-retail.product.description.a-line-2":"Aline2","sl-retail.product.description.a-very-fancy-shirt":"Averyfancyshirt","sl-retail.product.description.a-very-good-quality-shirt":"Averygoodqualityshirt","sl-retail.product.description.a-very-nice-shirt":"Averyniceshirt","sl-retail.product.description.a-very-spooky-mask":"Averyspookymask","sl-retail.product.description.able-to-be-tucked-away-in-store-until-the-next-year":"Abletobetuckedawayinstoreuntilthenextyear.","sl-retail.product.description.add-your-own-special-touch-to-your-home-office-or-anywhere-with-our-24x14-wooden-print-each-print-is-handmade-so-you-ll-never-find-any-two-that-look-exactly-the-same-with-its-own-grain-and-character-you-ll-be-proud-to-hang-these-custom-designed-wall-art-pieces":"Addyourownspecialtouchtoyourhome,office,oranywherewithour24x14”WoodenPrint.Eachprintishandmade,soyou’llneverfindanytwothatlookexactlythesame.Withitsowngrainandcharacter,you’llbeproudtohangthesecustom-designedwallartpieces.","sl-retail.product.description.adding-colon-ending":"Addingcolonending:","sl-retail.product.description.adjustable-elastic-ear-loops-that-can-be-tied-to-fit-individual-face-shapes":"Adjustableelasticearloopsthatcanbetiedtofitindividualfaceshapes","sl-retail.product.description.adjustable.cuffs.with.2.buttons":"Adjustablecuffswith2buttons","sl-retail.product.description.adjustable.velcro.strap.on.back":"Adjustablevelcrostraponback","sl-retail.product.description.adults-and-kids":"AdultandKidsizesailable","sl-retail.product.description.advanced-3d-print-technology-using-advanced-3d-digital-printing-technology-the-ime-is-vivid-the-color-is-bright-and-strong":"ADVANCED3DPRINTTECHNOLOGY:Usingadvanced3Ddigitalprintingtechnology,theimeisvivid,thecolorisbrightandstrong","sl-retail.product.description.air-layer-jacket-for-softness-and-breathability":"Airlayerjacketforsoftnessandbreathability","sl-retail.product.description.all-parts-in-diram-included":"Allpartsindiramincluded","sl-retail.product.description.anti-microbial":"Anti-microbialfootbed","sl-retail.product.description.anti-slip-feature-makes-it-suitable-for-the-shower-swimming-and-other-water-related-activities":"Anti-slipfeaturemakesitsuitablefortheshower,swimming,andotherwater-relatedactivities","sl-retail.product.description.antistatic-to-resist-shocks-lint-pet-hair":"Antistatictoresistshocks,lint,pethair","sl-retail.product.description.applicable-scene-leisure":"Applicablescene:Leisure","sl-retail.product.description.apply-to-any-hard-smooth-surface-including-paper-plastic-glass-wood-metal":"Applytoanyhardsmoothsurfaceincludingpaper,plastic,glass,wood,metal","sl-retail.product.description.approx-17cm-x-21-5cm-x-6-5cm":"Approx17cmX21.5cmX6.5cm","sl-retail.product.description.approx-19-5cm-x-11-56cm-x-3cm":"Approx19.5cmX11.56cmX.3cm","sl-retail.product.description.approx-37-3cm-x-24-5cm-x-21cm":"Approx37.3cmX24.5cmX21cm","sl-retail.product.description.approx-45-31-10":"Approx.45cmX31cmX10cm","sl-retail.product.description.arrives-ready-to-hang-with-pre-installed-coordinating-cord":"Arrivesreadytohangwithpre-installedcoordinatingcord","sl-retail.product.description.artfully-designed-for-fashionable-people-looking-to-add-a-personalized-touch-to-their-accessories-collection":"Artfullydesignedforfashionablepeoplelookingtoaddapersonalizedtouchtotheiraccessoriescollection","sl-retail.product.description.audio.pocket.with.headphone.exit.port":"Audiopocketwithheadphoneexitport","sl-retail.product.description.ailable-in-2-4m-3-6m-4-2m-sizes":"ailablein2.4M,3.6M,and4.2Msizes","sl-retail.product.description.ailable-in-8-sizes-including-a-round-and-runner-update-any-size-space-with-our-new-area-rugs-they-feature-durable-hemmed-edges-with-a-vibrant-chenille-print-face-and-coated-backing-with-a-stiff-lay-flat-design-these-area-rugs-are-great-for-any-room-in-your-home":"ailablein8sizesincludingaroundandrunner,updateanysizespacewithournewarearugs!Theyfeaturedurablehemmededgeswithavibrantchenilleprintfaceandcoatedbacking.Withastiff,lay-flatdesign,thesearearugsaregreatforanyroominyourhome.","sl-retail.product.description.ailable-in-gold-or-silver-color":"ailableinGoldorSilvercolor","sl-retail.product.description.ailable-in-white-or-pink-color":"ailableinWhiteorPinkcolor","sl-retail.product.description.back-of-covers-designed-with-an-elastic-fastening-system-for-a-secure-snug-fit":"Backofcoversdesignedwithanelasticfasteningsystemforasecure,snugfit","sl-retail.product.description.backed-with-non-slip-material-and-topped-with-polyester-felt-that-is-low-profile-to-reduce-chances-of-tripping":"Backedwithnon-slipmaterialandtoppedwithpolyesterfeltthatislow-profiletoreducechancesoftripping.","sl-retail.product.description.batteries-4aa-batteries-required-not-included":"Batteries:4AAbatteriesrequired(notincluded)","sl-retail.product.description.batteries-are-not-included":"Batteriesarenotincluded","sl-retail.product.description.batteries-not-included":"Batteriesnotincluded","sl-retail.product.description.battery-may-be-used-approx-8-hours-prior-to-needing-recharge":"Batterymaybeusedapprox.8hourspriortoneedingrecharge.","sl-retail.product.description.battery-may-be-used-for-approximately-8-hours":"Batterymaybeusedforapproximately8hours","sl-retail.product.description.beautifully-designed-for-the-chicest-people-in-your-life":"Beautifullydesignedforthechicestpeopleinyourlife","sl-retail.product.description.beautifully-hand-made-wall-art-that-is-made-in-the-usa-with-north-american-pine-the-pallet-look-adds-charm-and-character-because-each-board-is-unique-with-its-own-grain-and-character-art-is-printed-directly-onto-the-board-with-eco-friendly-zero-voc-ink-and-the-hanging-hardware-is-already-installed-so-it-s-ready-to-hang-right-away-for-your-enjoyment":"BeautifullyHandMadeWallArtthatisMadeintheUSAwithNorthAmericanPine,ThePalletlookaddscharmandcharacterbecauseeachboardisuniquewithitsowngrainandcharacter.ArtisprinteddirectlyontotheboardwithEcoFriendlyZeroVOCInkandthehanginghardwareisalreadyinstalled,soit’sreadytohangrightawayforyourenjoyment.","sl-retail.product.description.beautifully-handmade-wall-art-is-now-possible-with-our-wooden-print-our-10-5x10-5-wooden-print-is-the-ideal-size-for-shelves-desks-mantles-and-walls-this-home-decor-adds-charm-and-character-because-each-board-is-unique-with-its-own-grain-and-character":"BeautifullyhandmadewallartisnowpossiblewithourWoodenPrint!Our10.5x10.5”WoodenPrintistheidealsizeforshelves,desks,mantles,andwalls.Thishomedecoraddscharmandcharacterbecauseeachboardisuniquewithitsowngrainandcharacter.","sl-retail.product.description.beige-elasticized-gusset-on-the-edge-of-upper":"Beigeelasticizedgussetontheedgeofupper","sl-retail.product.description.bifold-wallet-design-is-made-of-high-grade-microfiber-leather":"Bifoldwalletdesignismadeofhigh-grade,microfiberleather","sl-retail.product.description.big-adventures-need-strong-bottles-and-our-vacuum-bottle-is-the-perfect-ally-for-keeping-your-beveres-safe":"Bigadventuresneedstrongbottles,andourVacuumBottleistheperfectallyforkeepingyourbeveressafe!","sl-retail.product.description.black-brush-oncTeeChip ‘Jos124; Loja de impressões personalizadas ‘Josep 124; camisetas, canecas, máscaras faciais, cartazes’e":"BlackBrushonce","sl-retail.product.description.blanket.measures-30x40":"Measures30inx40in-idealforyouth","sl-retail.product.description.blanket.measures-50x60":"Measures50inx60in","sl-retail.product.description.blanket.measures-60x80":"Measures60inx80in","sl-retail.product.description.blocks.out.light.and.provides.privacy":"Blocksoutlightandprovidesprivacy","sl-retail.product.description.bobbin-with-thread-and-needle-included":"Bobbinwiththreadandneedleincluded","sl-retail.product.description.breathable-and-sweat-absorbent":"Breathableandsweat-absorbent","sl-retail.product.description.brown-faux-pu-pigskin-insole-ream-canvas-lining-and-beige-eva-outsole-for-comfortable-wear":"BrownfauxPUpigskininsole,reamcanvaslining,andbeigeEVAoutsoleforcomfortablewear","sl-retail.product.description.brushed-on-both-sides-for-utmost-comfort":"Brushedonbothsidesforutmostcomfort","sl-retail.product.description.brushes":"Brushes","sl-retail.product.description.butterfly-charm-design":"ButterflyCharmDesign","sl-retail.product.description.button.detail.with.waist.straps.that.tie":"Buttondetailwithwaiststrapsthattie","sl-retail.product.description.c":"c","sl-retail.product.description.can-act-as-a-mounted-flower-pot-or-fish-bowl":"Canactasamountedflowerpot","sl-retail.product.description.can-be-worn-6-different-ways":"Canbeworn6differentways","sl-retail.product.description.capacity-12-oz":"Capacity:12oz","sl-retail.product.description.capacity-16-9-oz":"Capacity:16.9oz","sl-retail.product.description.capacity-20-oz":"Capacity:20oz.","sl-retail.product.description.capacity-20oz":"CAPACITY:20oz","sl-retail.product.description.capacity-24-oz":"Capacity:24oz","sl-retail.product.description.capacity-30-oz":"Capacity:30oz.","sl-retail.product.description.capacity-30oz":"CAPACITY:30oz","sl-retail.product.description.cardboard-cover-with-rounded-corners-and-elastic-closure":"Cardboardcoverwithroundedcornersandelasticclosure","sl-retail.product.description.carry-b-included-for-easy-transport-and-store":"Carrybincludedforeasytransportandstore","sl-retail.product.description.carrying-strap-included":"CarryingStrapincluded","sl-retail.product.description.children-under-the-e-of-8-should-not-play-with-small-puzzle-pieces-as-it-poses-a-choking-hazard":"Childrenundertheeof8shouldnotplaywithsmallpuzzlepieces,asitposesachokinghazard","sl-retail.product.description.classic-and-simple-design-is-suitable-for-both-men-and-women":"Classicandsimpledesignissuitableforbothmenandwomen","sl-retail.product.description.classic-look-with-canvas-vamp-and-quarter":"Classiclookwithcanvasvampandquarter","sl-retail.product.description.classic-medium-width-for-a-smooth-elegant-look":"Classicmediumwidthforaprofessionallook","sl-retail.product.description.classic.3-4.rlan.sleeves":"Classic3/4rlansleeves","sl-retail.product.description.classic.fit.order.a.size.down.for.slimmer.fit":"Classicfit.Orderasizedownforslimmerfit.","sl-retail.product.description.clean-with-a-cold-damp-cloth-do-not-use-harsh-chemicals":"Cleanwithacolddampcloth(donotuseharshchemicals)","sl-retail.product.description.clean.finished.fold.with.two.pearl.buttons":"Clean-finishedfoldwithtwopearlbuttons","sl-retail.product.description.cob-led-lights-in-the-lid":"COB&LEDlightsinthelid","sl-retail.product.description.cob-with-80-lumens":"COBwith80lumens","sl-retail.product.description.coffee-maker-description":"coffeemakerdescription","sl-retail.product.description.collapsible-folding-design-fits-inside-most-car-trunks-for-convenience-and-portability":"Collapsible,foldingdesignfitsinsidemostcartrunksforconvenienceandportability","sl-retail.product.description.color-black":"Color:Black","sl-retail.product.description.color-black-gray-pink-beige":"Color:Black,Gray,Pink,Beige","sl-retail.product.description.color-matched.drawstring":"Color-matcheddrawstring","sl-retail.product.description.color-may-be-little-different-due-to-monitor-thanks-for-your-understanding":"Colormaybelittledifferentduetomonitor,thanksforyourunderstanding.","sl-retail.product.description.color-red-and-black-plaid-black-and-white-plaid":"Color:Redandblackplaid-blackandwhiteplaid","sl-retail.product.description.color-white":"Color:White","sl-retail.product.description.comes-in-20pcs-set":"Comesin20pcsset","sl-retail.product.description.comes-in-30pcs-set":"Comesin30pcsset","sl-retail.product.description.comes-in-50pcs-set":"Comesin50pcsset","sl-retail.product.description.comes-in-a-two-pack-for-optimized-organization":"Comesinatwo-packforoptimizedorganization","sl-retail.product.description.comes-ready-with-an-attached-loop-for-immediate-hanging-on-your-tree":"Comesreadywithanattachedloopforimmediatehangingonyourtree.","sl-retail.product.description.comes-with-mop-bucket-4-mop-pads":"Comeswithmop,bucket,and4moppads","sl-retail.product.description.comes-with-three-interchangeable-brush-heads-base-and-a-brush-holder":"Comeswiththreeinterchangeablebrushheads,base,andabrushholder","sl-retail.product.description.comes-with-us-plug":"ComeswithUSPlug","sl-retail.product.description.comes-with-usb-cable":"ComeswithUSBcable","sl-retail.product.description.comfortable.knit.material":"Comfortableknitmaterial","sl-retail.product.description.comfy":"comfy","sl-retail.product.description.comma-afs":"Comma,:afs,:","sl-retail.product.description.comma-with-colon":"comma,withColon:","sl-retail.product.description.commas":"Commas,:","sl-retail.product.description.commas-plus-seimoolons":"Commas,plus:seimoolons","sl-retail.product.description.compatible-with-us-or-uk-charger":"CompatiblewithUSorUKcharger","sl-retail.product.description.consists-of-two-bill-compartments-five-credit-card-slots-and-one-clear-window":"Consistsoftwobillcompartments,fivecreditcardslots,andoneclearwindow","sl-retail.product.description.constructed-from-an-ultra-soft-polyester-fabric-with-a-hypo-allergenic-cotton-filling":"Constructedfromanultra-softpolyesterfabricwithahypo-allergeniccottonfilling.","sl-retail.product.description.constructed-with-high-quality-1200d-nylon-and-oxford-cloth-back":"Constructedwithhigh-quality1200Dnylonandoxfordclothback","sl-retail.product.description.constructed.soft.spun.polyester":"Constructedfromsoft,spunpolyester","sl-retail.product.description.contains-perfectly-interlocking-250-piece-jigsaw-puzzle-finished-size-is-18.25-x-12.25":"Containsperfectly-interlocking250piecejigsawpuzzle.Finishedsizeis18.25\"x12.25\"","sl-retail.product.description.contoured.and.side.seamed.for.a.feminine.fit":"Contouredandsideseamedforafemininefit","sl-retail.product.description.convenient-for-removing-blackheads":"Convenientforremovingblackheads","sl-retail.product.description.convenient-size-makes-it-easy-to-carry-while-still-offering-maximum-utility":"Convenientsizemakesiteasytocarrywhilestillofferingmaximumutility","sl-retail.product.description.convenient-to-carry-even-with-a-large-multipurpose-capacity-to-ensure-nothing-is-left-behind":"Convenienttocarryevenwithalarge,multipurposecapacitytoensurenothingisleftbehind","sl-retail.product.description.corrosion-resistant":"Corrosionresistant","sl-retail.product.description.cotton.web.handles":"Cottonwebhandles","sl-retail.product.description.cozy-underside-is-constructed-from-an-ultra-soft-micro-fleece-fabric-to-keep-you-warm-and-comfortable":"Cozyundersideisconstructedfromanultra-softmicrofleecefabrictokeepyouwarmandcomfortable.","sl-retail.product.description.cpsia.compliant":"CPSIAcompliant","sl-retail.product.description.create-a-casual-stylish-look-with-our-unisex-classic-canvas-slip-on-choose-the-perfect-design-for-your-personality-to-he-a-pair-of-shoes-you-ll-love-wearing-all-the-time":"Createacasual,stylishlookwithourUnisexClassicCanvasSlip-On!Choosetheperfectdesignforyourpersonalitytoheapairofshoesyou'lllovewearingallthetime.","sl-retail.product.description.create-wall-art-that-is-uniquely-yours-with-our-36x24-wooden-print-each-wooden-print-is-handmade-with-care-and-expertise-so-you-can-expect-nothing-short-of-beautiful-decor-that-has-its-own-unique-charm-and-character-these-wooden-prints-make-the-perfect-gifts-for-special-occasions-from-weddings-to-birthdays-and-everything-in-between":"Createwallartthatisuniquelyyourswithour36x24”WoodenPrint.Eachwoodenprintishandmadewithcareandexpertise,soyoucanexpectnothingshortofbeautifuldecorthathasitsownuniquecharmandcharacter.Thesewoodenprintsmaketheperfectgiftsforspecialoccasions,fromweddingstobirthdaysandeverythingin-between.","sl-retail.product.description.create-your-own-personalized-wall-art-to-add-charm-and-character-to-your-home-our-14x14-wooden-print-is-handmade-each-one-is-unique-with-its-own-grain-and-character-add-your-own-custom-designs-to-wall-art-that-you-hang-or-place-throughout-your-home-workplace-and-wherever-you-d-like":"Createyourownpersonalizedwallarttoaddcharmandcharactertoyourhome!Our14x14”WoodenPrintishandmade,eachoneisuniquewithitsowngrainandcharacter.Addyourowncustomdesignstowallartthatyouhangorplacethroughoutyourhome,workplace,andwhereveryou’dlike.","sl-retail.product.description.crew-neck-collar":"CrewNeckCollar","sl-retail.product.description.custom-cut-and-sewn-for-a-beautiful-finish-every-time":"Customcutandsewnforabeautifulfinisheverytime","sl-retail.product.description.custom-cut-and-sewn-for-a-flattering-look":"Customcutandsewnforaflatteringlook","sl-retail.product.description.custom-cut-and-sewn-for-a-perfect-fit-with-every-wear":"Customcutandsewnforaperfectfitwitheverywear","sl-retail.product.description.custom-cut-and-sewn-for-a-tailored-look":"Customcutandsewnforatailoredlook","sl-retail.product.description.custom-sut-sewn":"Customcutandsewn","sl-retail.product.description.decor-is-an-important-part-of-any-space-as-it-defines-the-atmosphere-in-the-room-our-24x36-wooden-print-is-handmade-with-beautiful-wood-so-each-piece-is-unique-with-its-own-character-and-charm-you-ll-love-hanging-it-up-on-the-walls-of-your-home-displaying-it-on-your-office-desk-the-possibilities-are-endless-they-also-make-great-gifts":"Decorisanimportantpartofanyspaceasitdefinestheatmosphereintheroom.Our24x36”WoodenPrintishandmadewithbeautifulwood,soeachpieceisuniquewithitsowncharacterandcharm.You’lllovehangingituponthewallsofyourhome,displayingitonyourofficedesk-thepossibilitiesareendless.Theyalsomakegreatgifts!","sl-retail.product.description.description":"Description...","sl-retail.product.description.description-for-line-1":"DescriptionforLine1","sl-retail.product.description.description-for-line-2":"DescriptionforLine2","sl-retail.product.description.description-for-line-3":"DescriptionforLine3","sl-retail.product.description.description-for-line-4":"DescriptionforLine4","sl-retail.product.description.description-for-line-5":"DescriptionforLine5","sl-retail.product.description.description-for-line-6":"DescriptionforLine6","sl-retail.product.description.description-for-line-7":"DescriptionforLine7","sl-retail.product.description.description-for-line-8":"DescriptionforLine8","sl-retail.product.description.description-for-line-9":"DescriptionforLine9","sl-retail.product.description.description-line-1":"DescriptionLine1","sl-retail.product.description.description-line-2":"DescriptionLine2","sl-retail.product.description.description-line-3":"DescriptionLine3","sl-retail.product.description.designed-for-people-who-want-to-upgrade-their-accessory-options":"Designedforpeoplewhowanttoupgradetheiraccessoryoptions","sl-retail.product.description.designed-for-quick-and-easy-installation-and-transportation":"Designedforquickandeasyinstallationandtransportation","sl-retail.product.description.designed-for-use-with-cool-beveres-only":"Designedforusewithcoolbeveresonly","sl-retail.product.description.designed-with-95-polyester-and-5-spandex-that-can-be-washed":"Designedwith95%polyesterand5%spandexthatcanbewashed","sl-retail.product.description.designed-with-an-eva-outsole-for-a-light-flexible-shoe":"DesignedwithanEVAoutsoleforalight,flexibleshoe","sl-retail.product.description.designed-with-fashion-mens-in-mind-this-is-the-next-must-he-accessory":"Designedwithfashionmensinmind,thisisthenextmust-heaccessory","sl-retail.product.description.designed-with-fast-and-easy-installation-and-convenience-in-mind":"Designedwithfastandeasyinstallationandconvenienceinmind","sl-retail.product.description.designed.and.printed.in.the.u.s.a.":"DesignedandprintedintheU.S.A.","sl-retail.product.description.detail-test":"Detailtest","sl-retail.product.description.details-test":"Detailstest","sl-retail.product.description.diameter-2mm":"Diameter:2mm","sl-retail.product.description.diameter-9-65":"Diameter:9.65\"","sl-retail.product.description.diameters-40cm-50cm-60cm-70cm":"Diameters:40cm,50cm,60cm,70cm","sl-retail.product.description.diamond-stitched-pattern":"Diamondstitchedpattern","sl-retail.product.description.digitally-printed-puzzle-with-semi-glossy-finish":"Digitallyprintedpuzzlewithsemi-glossyfinish","sl-retail.product.description.dimension-10-25in-x-13in-26cm-x-33cm":"Dimension:10.25inx13in(26cmx33cm)","sl-retail.product.description.dimensions-0-8in-diameter-circle-2cm":"Dimensions:0.8indiametercircle(2cm)","sl-retail.product.description.dimensions-1-1in-x-1-1in-2-8cm-x-2-8cm":"Dimensions:1.1inx1.1in(2.8cmx2.8cm)","sl-retail.product.description.dimensions-1-2in-x-1in-3cm-x-2-5cm":"Dimensions:1.2inwidthx1inheight(3cmx2.5cm)","sl-retail.product.description.dimensions-1-3in-x-1-3in-3-3cm-x-3-3cm":"Dimensions:1.3inx1.3in(3.3cmx3.3cm)","sl-retail.product.description.dimensions-11-l-x-11-w-x-9-65-h":"Dimensions:11\"(L)x11”(W)x9.65”(H)","sl-retail.product.description.dimensions-11in-x-16in-28cm-x-40-5cm":"Dimensions:11inx16in(28cmx40.5cm)","sl-retail.product.description.dimensions-11in-x-18-5in-28cm-x-47cm":"Dimensions:11inx18.5in(28cmx47cm)","sl-retail.product.description.dimensions-12in-x-18in-30-5cm-x-46cm":"Dimensions:12inx18in(30.5cmx46cm)","sl-retail.product.description.dimensions-14-5in-x-14-5in-37cm-x-37cm":"Dimensions:14.5inx14.5in(37cmx37cm)","sl-retail.product.description.dimensions-14-5in-x-15-4in-37cm-x-39cm":"Dimensions:14.5inx15.4in(37cmx39cm)","sl-retail.product.description.dimensions-14in-x-14in-35-5cm-x-35-5cm":"Dimensions:14inx14in(35.5cmx35.5cm)","sl-retail.product.description.dimensions-16in-x-24in-41cm-x-61cm":"Dimensions:16inx24in(41cmx61cm)","sl-retail.product.description.dimensions-1in-diameter-circle-2-5cm":"Dimensions:1indiametercircle(2.5cm)","sl-retail.product.description.dimensions-1in-x-1-25in-teardrop-2-8cm-x-3-3cm-teardrop":"Dimensions:1inwidthx1.25inheight(2.8cmx3.3cm)","sl-retail.product.description.dimensions-1in-x-1in-2-5cm-x-2-5cm":"Dimensions:1inx1in(2.5cmx2.5cm)","sl-retail.product.description.dimensions-2-1in-by-2-1in-5-3cm-x-5-3cm":"Dimensions:2.1inby2.1in(5.3cmx5.3cm)","sl-retail.product.description.dimensions-2-5in-diameter-circle-6-4cm":"Dimensions:2.5indiametercircle(6.4cm)","sl-retail.product.description.dimensions-20in-x-30in-52cm-x-76-2cm":"Dimensions:20inx30in(52cmx76.2cm)","sl-retail.product.description.dimensions-3-8in-x-56in-9-7cm-x-142cm":"Dimensions:3.8inx56in(9.7cmx142cm)","sl-retail.product.description.dimensions-30in-x-60in-76cm-x-152cm":"Dimensions:30inx60in(76cmx152cm)","sl-retail.product.description.dimensions-4-3in-x-4-3in-11cm-x-11cm":"Dimensions:4.3inx4.3in(11cmx11cm)","sl-retail.product.description.dimensions-4-5in-x-12-5in-11-5cm-x-32cm":"Dimensions:4.5inx12.5in(11.5cmx32cm)","sl-retail.product.description.dimensions-7-75in-x-9-25in-20cm-x-24cm":"Dimensions:7.75inx9.25in(20cmx24cm)","sl-retail.product.description.dimensions-8in-x-11-25in-20-5cm-x-28-6cm":"Dimensions:8inx11.25in(20.5cmx28.6cm)","sl-retail.product.description.dimensions-8in-x-12in-20cm-x-30-5cm":"Dimensions:8inx12in(20cmx30.5cm)","sl-retail.product.description.dimensions-8in-x-diameter-circle-20cm":"Dimensions:8indiametercircle(20cm)","sl-retail.product.description.dimensions-9-3in-x-17-5in-23-5cm-x-44-5cm":"Dimensions:9.3inx17.5in(23.5cmx44.5cm)","sl-retail.product.description.dimensions.11.inches.x.17.inches":"Dimensions11inchesx17inches","sl-retail.product.description.dimensions.16.inches.x.24.inches":"Dimensions16inchesx24inches","sl-retail.product.description.dimensions.17.inches.x.11.inches":"Dimensions17inchesx11inches","sl-retail.product.description.dimensions.17in.x.5.5in.x.12in.43cm.x.14cm.x.30cm":"Dimensions:17inx5.5inx12in(43cmx14cmx30cm)","sl-retail.product.description.dimensions.24.inches.x.16.inches":"Dimensions24inchesx16inches","sl-retail.product.description.dimensions.24.inches.x.36.inches":"Dimensions24inchesx36inches","sl-retail.product.description.dimensions.3-5in-diameter-circle-8-9cm":"Dimensions:3.5indiametercircle(8.9cm)","sl-retail.product.description.dimensions.36.inches.x.24.inches":"Dimensions36inchesx24inches","sl-retail.product.description.dimensions.unrolled.7.5in.x.12.5in.19cm.x.32cm":"Dimensions(unrolled):7.5inx12.5in(19cmx32cm)","sl-retail.product.description.dishwasher-and-microwe-safe":"Dishwasherandmicrowesafe","sl-retail.product.description.dishwasher-and-microwe-safe-for-easy-cleaning-and-reheating-your-forite-drinks-respectively":"Dishwasherandmicrowesafe,foreasycleaningandreheatingyourforitedrinks,respectively","sl-retail.product.description.dishwasher-safe":"DishwasherSafe","sl-retail.product.description.dishwasher.and.microwe.safe":"Dishwasherandmicrowesafe","sl-retail.product.description.dishwasher.safe":"Dishwashersafe","sl-retail.product.description.do-not-microwe-or-place-in-freezer":"Donotmicroweorplaceinfreezer.","sl-retail.product.description.do-not-microwe-or-place-in-the-freezer":"Donotmicroweorplaceinthefreezer","sl-retail.product.description.double-needle.ribbed.binding.on.neck.shoulders.sleeves.and.leg.openings.":"Double-needleribbedbindingonneck,shoulders,sleevesandlegopenings.","sl-retail.product.description.double-o-shaped-for-comfort-and-breath":"DoubleOshapeddesignforcomfortandbreathability","sl-retail.product.description.double-sided-adhesive-washable-and-reusable":"Double-sidedadhesive,washable,andreusable.","sl-retail.product.description.double-stitched-collar-and-armholes":"Doublestitchedcollarandarmholes","sl-retail.product.description.double-wall-stainless-steel-vacuum-construction-with-copper-insulation-perfect-for-cold-and-hot-beveres":"Double-wallstainlesssteelvacuumconstructionwithcopperinsulation,perfectforcoldandhotbeveres","sl-retail.product.description.double-wall-vacuum-stainless-steel-viking-tumbler-with-copper-lining-and-press-in":"DoublewallvacuumstainlesssteelVikingtumblerwithcopperliningandpress-in","sl-retail.product.description.double-wall-vacuum-stainless-steel-viking-tumbler-with-copper-lining-and-press-in-drink-thru-lid":"DoublewallvacuumstainlesssteelVikingtumblerwithcopperliningandpress-in,drink-thrulid","sl-retail.product.description.double.lined.hood.with.matching.drawstring":"Doublelinedhoodwithmatchingdrawstring","sl-retail.product.description.double.sided.print":"Double-sidedprinting","sl-retail.product.description.double.sided.print.zip.closure":"Doublesidedprintwithzipclosure","sl-retail.product.description.double.square.quilted.pattern":"Doublesquarequiltedpattern","sl-retail.product.description.double.stitched.ribbed.binding.on.neck.shoulders.sleeves.and.leg.openings.":"Doublestitchedribbedbindingonneck,shoulders,sleevesandlegopenings.","sl-retail.product.description.drink-thru-lid":"Drink-thrulid","sl-retail.product.description.dry-sweat-fabric":"Dry-fast,sweat-wickingfabric","sl-retail.product.description.dual-chamber-bucket":"DualChamberBucket","sl-retail.product.description.duo-function-lid-unscrews-in-2-spots-the-lower-seal-provides-a-wide-opening-to-insert-ice-cubes-and-the-upper-seal-is-designed-for-standard-use-on-the-go":"Duofunctionlidunscrewsin2spots:thelowersealprovidesawideopeningtoinserticecubes,andtheuppersealisdesignedforstandarduseonthego","sl-retail.product.description.durable-aluminum-material":"Durablealuminummaterial","sl-retail.product.description.durable-hemmed-edges-with-a-vibrant-chenille-print-face-and-coated-backing-stiff-lay-flat-design":"Durablehemmededgeswithavibrantchenilleprintfaceandcoatedbacking.Stiff,layflatdesign.","sl-retail.product.description.durable-lightweight-4mm-corrugated-plastic":"Durable,lightweight4mmcorrugatedplastic","sl-retail.product.description.durable-polyester-cloth-face-covering":"Durablepolyesterclothfacecovering","sl-retail.product.description.durable-ribbed-collar":"Durableribbedcollar","sl-retail.product.description.durable-rubber-backing-with-polyester-cover":"Durablerubberbackingwithpolyestercover","sl-retail.product.description.durable-silver-bracelet-chain":"Durablesilverbraceletchain","sl-retail.product.description.durable-tempered-glass-with-print-on-underside":"Durabletemperedglasswithprintonunderside","sl-retail.product.description.durable-zinc-alloy-bracelet-charm":"Durablezincalloybraceletcharm","sl-retail.product.description.durable-zinc-alloy-material":"Durablezincalloymaterial","sl-retail.product.description.durable.left.chest.pocket":"Durableleftchestpocket","sl-retail.product.description.durable.rib.knit.neck":"Durableribknitneck","sl-retail.product.description.durable.tread.pattern.on.surface":"Durabletreadpatternonsurface","sl-retail.product.description.dust-resistant-and-anti-scratch-surfaces-keep-your-lugge-clean-and-protected":"Dust-resistantandanti-scratchsurfaceskeepyourluggecleanandprotected","sl-retail.product.description.dye-sublimated-for-exceptional-print-clarity":"Dyesublimatedforexceptionalprintclarity","sl-retail.product.description.dye-sublimation-graphics-for-exceptional-prints":"DyeSublimationgraphicsforexceptionalprints","sl-retail.product.description.dye.sublimation.graphics.for.exceptional.prints":"DyeSublimationgraphicsforexceptionalprints","sl-retail.product.description.each-blanket-features-a-premium-suede-polyester-print-for-beautiful-color-vibrancy":"Eachblanketfeaturesapremiumsuedepolyesterprintforbeautifulcolorvibrancy.","sl-retail.product.description.each-pair-of-leggings-is-constructed-with-a-high-quality-82-polyester-18-spandex-blend":"Eachpairofleggingsisconstructedwithahighquality82%polyester,18%spandexblend.","sl-retail.product.description.each-quilt-bed-set-includes-a-pair-of-two-pillow-covers-that-feature-a-one-sided-print-seamless-dual-flap-closure-and-do-not-include-pillow-inserts":"Eachquiltbedsetincludesapairoftwopillowcoversthatfeatureaone-sidedprint,seamlessdualflapclosureanddonotincludepillowinserts.","sl-retail.product.description.each-quilt-features-a-premium-polyester-print-for-beautiful-color-vibrancy-even-after-washing":"Eachquiltfeaturesapremiumpolyesterprintforbeautifulcolorvibrancy,evenafterwashing.","sl-retail.product.description.easy-access-to-lugge-handles-with-left-side-slits":"Easyaccesstoluggehandleswithleft-sideslits","sl-retail.product.description.easy-installation-with-adjustable-buckles-and-elastic-strap-on-top-and-bottom":"Easyinstallationwithadjustablebucklesandelasticstrapontopandbottom","sl-retail.product.description.easy-pull-on-style":"Easypull-onstyle","sl-retail.product.description.easy-to-inflate":"Easytoinflateandputon:simplystepintothecostume,turnonthefan(discreetlyhiddeninsidetheoutfit)andyouwillbefullyinflatedwithin60seconds.","sl-retail.product.description.easy-to-tear-off-and-will-not-dame-your-wall-or-any-surface-it-s-on":"Easytotearoffandwillnotdameyourwalloranysurfaceit'son.","sl-retail.product.description.easy-to-tuck-away-in-store-for-next-year":"Easytotuckawayinstorefornextyear.","sl-retail.product.description.easy.to.wash.and.clean.":"Easytowashandclean.","sl-retail.product.description.eco-friendly-all-our-items-use-zero-voc-inks":"ECOFRIENDLY:AllouritemsuseZeroVOCinks","sl-retail.product.description.edge-to-edge.print.with.no.borders":"Edge-to-edgeprintwithnoborders","sl-retail.product.description.edges-are-embroided-with-a-handmade-stitch-for-maximum-durability-and-a-homemade-feel":"Edgesareembroidedwithahandmadestitchformaximumdurabilityandahomemadefeel.","sl-retail.product.description.egstt":"egstt","sl-retail.product.description.elastic-and-soft-waistband-for-a-comfortable-fit":"Elasticandsoftwaistbandforacomfortablefit","sl-retail.product.description.elastic-ear-loops":"Elasticearloops","sl-retail.product.description.elastic-waist":"Elasticwaist","sl-retail.product.description.elastic-waistband-with-fine-trim-for-a-comfortable-fit-and-an-elegant-look":"Elasticwaistbandwithfinetrimforacomfortablefitandanelegantlook","sl-retail.product.description.elastic.bands.at.cuffs.and.bottom.hem":"Elasticbandsatcuffsandbottomhem","sl-retail.product.description.elasticized-waistband-with-adjustable-drawstring-for-a-gently-snug-fit":"Elasticizedwaistbandwithadjustabledrawstringforagentlysnugfit","sl-retail.product.description.electronic-brush-for-easy-cleaning":"Electronicbrushforeasycleaning","sl-retail.product.description.elevate-your-look-with-a-beautiful-horizontal-women-s-leather-wallet-this-everyday-accessory-deserves-an-upgrade-and-now-you-can-get-it-just-the-way-you-like-it":"ElevateyourlookwithabeautifulhorizontalWomen'sLeatherWallet.Thiseverydayaccessorydeservesanupgrade,andnowyoucangetitjustthewayyoulikeit.","sl-retail.product.description.embroidered.in.the.u.s.a.":"EmbroideredintheU.S.A.","sl-retail.product.description.enjoy-your-drinks-in-style-thanks-to-our-30-oz-cone-glittering-tumbler-these-work-well-for-all-different-activities-and-make-great-gifts-for-everyone-in-your-life-this-larger-size-makes-it-suitable-for-yourself-or-for-sharing-stay-hydrated-while-hing-some-fun-with-these-colorful-glittering-options-to-consume-your-forite-beveres":"Enjoyyourdrinksinstylethankstoour30oz.ConeGlitteringTumbler!Theseworkwellforalldifferentactivitiesandmakegreatgiftsforeveryoneinyourlife.Thislargersizemakesitsuitableforyourselforforsharing.Stayhydratedwhilehingsomefunwiththesecolorful,glitteringoptionstoconsumeyourforitebeveres.","sl-retail.product.description.enjoy-your-forite-hot-and-cold-beveres-in-our-stylish-wine-tumblers":"Enjoyyourforitehotandcoldbeveresinourstylishwinetumblers!","sl-retail.product.description.enjoy-your-forite-hot-and-cold-beveres-with-our-stylish-wine-tumblers":"EnjoyyourforitehotandcoldbevereswithourstylishWineTumblers!","sl-retail.product.description.ensure-stylish-comfort-with-our-boxers-briefs":"Ensurestylishcomfortwithourboxersbriefs.","sl-retail.product.description.envelope-flap-closure-on-back-side":"Envelopeflapclosureonbackside","sl-retail.product.description.ergonomic-handle":"ErgonomicHandle","sl-retail.product.description.every-man-needs-the-perfect-go-to-t-shirt-in-their-closet-and-this-men-s-aop-shirt-is-the-one-you-ll-soon-realize-you-re-reaching-for-this-printed-t-shirt-more-than-any-of-the-other-pieces-in-your-closet-for-its-versatility-and-comfort-grab-a-few-in-different-prints-to-he-a-great-custom-t-shirt-for-every-day-of-the-week":"Everymanneedstheperfectgo-tot-shirtintheirclosetandthisMen’sAOPShirtistheone.You’llsoonrealizeyou’rereachingforthisprintedt-shirtmorethananyoftheotherpiecesinyourclosetforitsversatilityandcomfort.Grabafewindifferentprintstoheagreatcustomt-shirtforeverydayoftheweek!","sl-retail.product.description.every-stylish-figure-needs-our-horizontal-women-s-clutch-purse-to-complete-their-look-take-any-outfit-from-drab-to-fab-with-this-accessory-that-does-more-than-holding-your-belongings":"EverystylishfigureneedsourhorizontalWomen'sClutchPursetocompletetheirlook.Takeanyoutfitfromdrabtofabwiththisaccessorythatdoesmorethanholdingyourbelongings.","sl-retail.product.description.expanded-size-7-28-w-x-7-28-h-folded-size-3-54-w-x-7-28-h-weight-4-73-oz":"Expandedsize:7.28\"(W)x7.28\"(H).Foldedsize:3.54\"(W)x7.28\"(H).Weight:4.73oz.","sl-retail.product.description.expanded-size-7-87-w-x-4-72-h-folded-size-3-93-w-x-4-72-h-weight-3-77-oz":"Expandedsize:7.87\"(W)x4.72\"(H).Foldedsize:3.93\"(W)x4.72\"(H).Weight:3.77oz.","sl-retail.product.description.expanded-size-9-45-w-x-3-62-h-folded-size-4-72-w-x-3-62-h-weight-2-68-oz":"Expandedsize:9.45\"(W)x3.62\"(H).Foldedsize:4.72\"(W)x3.62\"(H).Weight:2.68oz.","sl-retail.product.description.exterior-material-201-stainless-steel-with-powder-coating":"Exteriormaterial:201stainlesssteelwithpowdercoating","sl-retail.product.description.fabric-100-polyester":"Fabric:100%polyester","sl-retail.product.description.fabric-name-polyester-fiber":"Fabricname:Polyesterfiber","sl-retail.product.description.fade.resistant":"Fade-resistant","sl-retail.product.description.fancy-tshirt":"Fancytshirt","sl-retail.product.description.fashionable-designs-perfect-for-a-home-a-business-or-a-unique-gift":"Fashionabledesignsperfectforahome,abusiness,orauniquegift","sl-retail.product.description.fdaed":"fdaed","sl-retail.product.description.featfeaure-fine-workmanship-exquisite-design-suitable-for-kitchen-use":"Featfeaurefineworkmanshipexquisitedesignsuitableforkitchenuse","sl-retail.product.description.features-11-card-slots-one-clear-window-and-three-full-length-pockets-for-cash":"Features11cardslots,oneclearwindow,andthreefull-lengthpocketsforcash","sl-retail.product.description.features-2-tiers-of-lights":"Features2tiersoflights:","sl-retail.product.description.features-2-tiers-of-lights-press-button-to-turn-cob-light-on-the-upper-panel-press-button-a-second-time-to-turn-led-light-on-lower-panel-third-press-of-button-turns-light-off":"Features2tiersoflights:PressbuttontoturnCOBlightontheupperpanel;pressbuttonasecondtimetoturnLEDlightonlowerpanel(thirdpressofbuttonturnslightoff)","sl-retail.product.description.features-a-crew-neck-and-set-in-sleeve":"Featuresacrewneckandset-insleeve","sl-retail.product.description.features-a-large-capacity-interior-12-card-slots-one-zipper-pocket-one-clear-window-and-two-full-length-pockets":"Featuresalargecapacityinterior:12cardslots,onezipperpocket,oneclearwindow,andtwofull-lengthpockets","sl-retail.product.description.features-a-premium-suede-polyester-print-for-beautiful-color-vibrancy":"Featuresapremiumsuedepolyesterprintforbeautifulcolorvibrancy.","sl-retail.product.description.features-a-specialty-high-definition-heat-dye-application-that-ensures-long-lasting-color-vibrancy-even-after-machine-washing":"Featuresaspecialtyhighdefinitionheat-dyeapplicationthatensureslonglastingcolorvibrancyevenaftermachinewashing.","sl-retail.product.description.features-a-wristlet-strap-handle-for-convenient-carrying-wherever-you-go":"Featuresawristletstraphandleforconvenientcarryingwhereveryougo","sl-retail.product.description.feel-confident-and-comfy-with-our-super-soft-briefs":"Feelconfidentandcomfywithoursuper-softbriefs.","sl-retail.product.description.feel-sexy-and-comfortable-with-our-lace-panties":"Feelsexyandcomfortablewithourlacepanties.","sl-retail.product.description.filled.down.alternative":"Filledwithdown-alternative","sl-retail.product.description.finished-size-7-x-3-5":"Finishedsize:7\"X3.5\"","sl-retail.product.description.finished-with-an-elasticated-waistband-to-help-reduce-hip-pressure-for-a-perfect-and-stylish-fit":"Finishedwithanelasticatedwaistbandtohelpreducehippressureforaperfectandstylishfit.","sl-retail.product.description.fish":"Fish","sl-retail.product.description.fish-plant-inside-contents-not-included":"Fishplantinsidecontentsnotincluded","sl-retail.product.description.fits-perfectly-in-most-cup-holders":"Fitsperfectlyinmostcupholders","sl-retail.product.description.fits-standard-hose":"Fitsstandard5/8”hose","sl-retail.product.description.fl-hangs-vertically-with-2-opening-at-top-for-stand-or-pole":"Flhangsverticallywith2\"\"openingattopforstandorpole","sl-retail.product.description.fl-stand-and-pole-not-included":"Flstandandpolenotincluded","sl-retail.product.description.flatlock.seams":"Flatlockseams","sl-retail.product.description.flip-flops-are-convenient-year-round-and-our-men-s-flip-flops-give-you-a-stylish-comfortable-option-for-your-lifestyle-run-errands-hit-the-pool-or-do-whatever-you-want-in-our-men-s-flip-flops-everyone-in-your-household-will-want-their-own-pair-so-grab-a-few-to-keep-around-the-house":"Flipflopsareconvenientyear-round,andourMen'sFlipFlopsgiveyouastylish,comfortableoptionforyourlifestyle.Runerrands,hitthepool,ordowhateveryouwantinourMen'sFlipFlops.Everyoneinyourhouseholdwillwanttheirownpair,sograbafewtokeeparoundthehouse.","sl-retail.product.description.food-grade-safety":"Food-gradesafety","sl-retail.product.description.for-quality-care-wash-with-cold-water-on-a-gentle-cycle-with-mild-detergent":"Forqualitycare,washwithcoldwateronagentlecyclewithmilddetergent","sl-retail.product.description.form.fitting.without.side.seams":"Formfittingwithoutsideseams","sl-retail.product.description.four-multifunctional-pockets-provide-ample-space-to-store-essentials-with-easy-access":"Fourmultifunctionalpocketsprovideamplespacetostoreessentialswitheasyaccess","sl-retail.product.description.four-sided-volleyball-net":"Foursidedvolleyballnet","sl-retail.product.description.frames-ailable-in-black-walnut-and-white-finishes":"Framesailableinblack,walnutandwhitefinishes","sl-retail.product.description.front.pouch.pocket":"Frontpouchpocket","sl-retail.product.description.front.zippered.outside.pocket":"Front-zipperedoutsidepocket","sl-retail.product.description.full-canvas-upper-round-toe":"Fullcanvasupper,roundtoe","sl-retail.product.description.full-zipper-closure":"Fullzipperclosure","sl-retail.product.description.gently-removes-blackheads":"Gentlyremovesblackheads","sl-retail.product.description.gently.softens.light.with.a.subtle.texture":"Gentlysoftenslightwithasubtletexture","sl-retail.product.description.gest":"gest","sl-retail.product.description.get-your-drinks-ready-our-30-oz-straight-glittering-tumbler-is-here-with-this-larger-than-normal-capacity-and-a-cylindrical-shape-you-can-stay-hydrated-for-longer-no-matter-where-you-are-take-this-eco-friendly-glittering-tumbler-with-you-to-your-next-picnic-on-your-forite-hike-or-use-it-to-keep-your-drink-ready-at-home":"Getyourdrinksready-our30oz.StraightGlitteringTumblerishere!Withthislarger-than-normalcapacityandacylindricalshape,youcanstayhydratedforlongernomatterwhereyouare.Takethiseco-friendlyGlitteringTumblerwithyoutoyournextpicnic,onyourforitehike,oruseittokeepyourdrinkreadyathome.","sl-retail.product.description.give-a-contemporary-look-to-your-bathroom-or-bedroom-with-our-modern-laundry-baskets":"Giveacontemporarylooktoyourbathroomorbedroomwithourmodernlaundrybaskets.","sl-retail.product.description.gloss-white-coating":"Glosswhitecoating","sl-retail.product.description.gloss-white-insert-for-sublimation-print":"Glosswhiteinsertforsublimationprint","sl-retail.product.description.glows-in-the-dark":"Glowsinthedark","sl-retail.product.description.gone-are-the-days-of-digging-around-in-your-car-looking-for-that-thing-you-lost-months-o-keep-your-car-clean-organized-and-ready-at-a-moment-s-notice-with-our-car-seat-back-organizer-you-ll-soon-learn-that-these-are-so-helpful-and-convenient-you-ll-want-one-for-every-seat":"Gonearethedaysofdiggingaroundinyourcarlookingforthatthingyoulostmonthso.Keepyourcarclean,organized,andreadyatamoment'snoticewithourCarSeatBackOrganizer.You’llsoonlearnthatthesearesohelpfulandconvenient,you’llwantoneforeveryseat!","sl-retail.product.description.graphic-changes-when-hot-water-is-added":"Graphicchangeswhenhotwaterisadded","sl-retail.product.description.graphic-changes-when-hot-water-is-added-so-you-ll-know-when-your-bevere-gets-cold":"Graphicchangeswhenhotwaterisadded,soyou’llknowwhenyourbeveregetscold","sl-retail.product.description.graphic.changes.when.hot.water.is.added":"Graphicchangeswhenhotwaterisadded","sl-retail.product.description.grey":"Grey","sl-retail.product.description.hand-wash-only":"Handwashonly","sl-retail.product.description.handmade-this-beautiful-wood-board-is-made-from-north-american-pine-wood":"HANDMADE:ThisBeautifulWoodBoardisMadefromNorthAmericanPinewood","sl-retail.product.description.hardboard-material-with-white-gloss-finish":"Hardboardmaterialwithwhiteglossfinish","sl-retail.product.description.hey-duty-but-lightweight-only-3.6-lbs-0.25-thickness":"Heyduty,butlightweight-only3.6lbs0.25\"thickness","sl-retail.product.description.hello":"Hello","sl-retail.product.description.helps-to-relieve-chronic-back-pain":"Helpstorelievechronicbackpain","sl-retail.product.description.hemmed.edges.with.a.vibrant.print":"Hemmededgeswithavibrantprint","sl-retail.product.description.high-ankle-with-lace-up-design":"Highanklewithlaceupdesign","sl-retail.product.description.high-density.fabric.for.exceptional.print.clarity":"High-densityfabricforexceptionalprintclarity","sl-retail.product.description.high-density.fabric.for.vivid.print.clarity":"High-densityfabricforvividprintclarity","sl-retail.product.description.high-quality-and-waterproof-print":"Highqualityandwaterproofprint","sl-retail.product.description.high-quality-stainless-steel":"HighQualityStainlessSteel","sl-retail.product.description.ideal-for-camping-fishing-hiking-picnics-and-a-variety-of-outdoor-activities-our-folding-fish-stool-makes-it-easy-to-be-an-adventurer-on-the-go-get-a-few-stools-to-ensure-everyone-in-your-group-has-one-to-use":"Idealforcamping,fishing,hiking,picnics,andavarietyofoutdooractivities,ourFoldingFishStoolmakesiteasytobeanadventureronthego.Getafewstoolstoensureeveryoneinyourgrouphasonetouse!","sl-retail.product.description.in-search-of-an-inexpensive-yet-beautiful-way-to-upgrade-a-space-our-17-5x24-wooden-print-is-it-add-a-rustic-touch-with-charm-and-character-and-choose-a-design-that-makes-your-wall-art-stand-out-you-ll-never-find-a-piece-as-unique-as-yours-so-share-this-discovery-with-friends-and-family-as-this-makes-a-perfect-gift-too":"Insearchofaninexpensiveyetbeautifulwaytoupgradeaspace?Our17.5x24”WoodenPrintisit!Addarustictouchwithcharmandcharacterandchooseadesignthatmakesyourwallartstandout.You’llneverfindapieceasuniqueasyours,sosharethisdiscoverywithfriendsandfamilyasthismakesaperfectgift,too.","sl-retail.product.description.included-wristlet-strap-handle-makes-sure-it-s-always-where-you-want-it-to-be":"Includedwristletstraphandlemakessureit’salwayswhereyouwantittobe","sl-retail.product.description.includes-5-replaceable-heads-and-charging-cable":"Includes5replaceableheadsandchargingcable","sl-retail.product.description.includes-eight-card-slots-one-zipper-pocket-one-phone-pocket-and-two-full-length-pockets":"Includeseightcardslots,onezipperpocket,onephonepocket,andtwofull-lengthpockets","sl-retail.product.description.includes-four-card-slots-one-clear-window-and-two-full-length-pockets-for-cash-or-anything-you-need-to-hold-multipurpose-large-capacity-makes-it-easy-to-always-he-everything-you-need":"Includesfourcardslots,oneclearwindow,andtwofull-lengthpocketsforcashoranythingyouneedtohold.Multipurpose,largecapacitymakesiteasytoalwaysheeverythingyouneed.","sl-retail.product.description.includes-hoop":"IncludesHoop","sl-retail.product.description.includes-left-side-slits-for-easy-access-to-lugge-handles":"Includesleft-sideslitsforeasyaccesstoluggehandles","sl-retail.product.description.includes.zipper.closure":"Includeshiddenzipperclosure","sl-retail.product.description.incorporates-advanced-3d-digital-printing-technology-so-the-ime-result-is-vivid-and-bright":"Incorporatesadvanced3Ddigitalprintingtechnology,sotheimeresultisvividandbright","sl-retail.product.description.inner-layer-hydrophilic-absorbent-soft-organic-cotton-fabric":"InnerLayerhydrophilicabsorbentsoftorganiccottonfabric","sl-retail.product.description.inside-contents-such-as-fish-and-plant-are-not-included":"Insidecontentsplantsarenotincluded","sl-retail.product.description.inside-liner-provides-secure-phone-store-and-keeps-it-out-of-the-way":"Insidelinerprovidessecurephonestoreandkeepsitoutoftheway","sl-retail.product.description.interior-features-include-multifunctional-pockets-and-meticulously-finished-billfolds":"Interiorfeaturesincludemultifunctionalpocketsandmeticulouslyfinishedbillfolds","sl-retail.product.description.interior-lining-is-constructed-from-an-ultra-soft-polyester-wool-like-fabric-for-warmth-and-comfort":"Interiorliningisconstructedfromanultra-softpolyesterwool-likefabricforwarmthandcomfort.","sl-retail.product.description.interior-material-304-stainless-steel":"Interiormaterial:304stainlesssteel","sl-retail.product.description.it-can-be-used-on-any-surface-without-causing-any-dame":"Itcanbeusedonanysurfacewithoutcausinganydame.","sl-retail.product.description.it-s-time-to-say-goodbye-to-your-old-flip-flops-and-say-hello-to-our-stylish-women-s-flip-flops-comfortable-durable-and-fashionable-our-women-s-flip-flops-offer-versatility-for-every-lifestyle-pick-up-a-few-pairs-to-keep-around-the-house-for-the-ultimate-convenience":"It'stimetosaygoodbyetoyouroldflipflops,andsayhellotoourstylishWomen’sFlipFlops!Comfortable,durable,andfashionable,ourWomen’sFlipFlopsofferversatilityforeverylifestyle.Pickupafewpairstokeeparoundthehousefortheultimateconvenience!","sl-retail.product.description.item-must-be-charged-prior-to-first-use-charge-time-varies-by-device-min-3-5-hrs":"Itemmustbechargedpriortofirstuse.Chargetimevariesbydevice,min3.5hrs.","sl-retail.product.description.item-size-21cm-8cm-3-4cm-l-w-h":"ItemSize:21cm*8cm*3.4cm(L*W*H)","sl-retail.product.description.item.unframed":"Thisitemisunframed","sl-retail.product.description.just-a-shoe":"Justashoe","sl-retail.product.description.kangaroo-pocket-fringes":"Kangaroopocketfringes","sl-retail.product.description.keeps-liquid-cool-for-24-hrs":"Keepsliquidcoolfor24hrs","sl-retail.product.description.keeps-liquid-cool-for-24hrs":"Keepsliquidcoolfor24hrs","sl-retail.product.description.keeps-liquid-hot-for-5-5-hrs":"Keepsliquidhotfor5.5hrs","sl-retail.product.description.keeps-liquid-hot-for-5-5hrs":"Keepsliquidhotfor5.5hrs","sl-retail.product.description.lace-pattern-on-the-side-and-back":"Lacepatternonthesideandback","sl-retail.product.description.lace-up-closure-for-an-adjustable-fit":"Lace-upclosureforanadjustablefit","sl-retail.product.description.large-interior-features-11-card-slots-one-clear-window-and-three-full-length-pockets-for-multipurpose-use":"Largeinteriorfeatures11cardslots,oneclearwindow,andthreefull-lengthpocketsformultipurposeuse","sl-retail.product.description.large.main.compartment.zippered":"Largemaincompartment(zippered)","sl-retail.product.description.leather":"Leather","sl-retail.product.description.leggings-1":"Leggings1","sl-retail.product.description.length-9-8-feet-16-4-feet-and-32-8-feet":"Length:9.8feet,16.4feet,and32.8feet.","sl-retail.product.description.let-your-baby-or-toddler-dress-comfy-for-both-sleep-and-play-with-our-cute-baby-onesies":"Letyourbabyortoddlerdresscomfyforbothsleepandplaywithourcutebabyonesies.","sl-retail.product.description.let-your-thoughts-and-ideas-come-to-life-in-our-beautiful-notebooks":"Letyourthoughtsandideascometolifeinourbeautifulnotebooks!","sl-retail.product.description.light-shooting-and-different-displays-may-cause-the-color-of-the-item-in-the-picture-a-little-different-from-the-real-thing":"Lightshootinganddifferentdisplaysmaycausethecoloroftheiteminthepicturealittledifferentfromtherealthing","sl-retail.product.description.light-turns-off-by-pressing-the-button-three-times":"Lightturnsoffbypressingthebuttonthreetimes","sl-retail.product.description.lightweight-for-easy-movement":"Lightweightforeasymovement","sl-retail.product.description.lightweight-material":"LightweightMaterial","sl-retail.product.description.line":"line","sl-retail.product.description.line-5-blackhead-remover":"Line5:BlackheadRemover","sl-retail.product.description.liner-comfortable-elastane":"Liner:ComfortableElastane","sl-retail.product.description.liven-up-a-dull-space-and-lee-a-memorable-impression-with-our-unique-wall-clocks":"Livenupadullspaceandleeamemorableimpressionwithouruniquewallclocks!","sl-retail.product.description.looking-to-add-some-charm-and-character-to-your-space-our-14x24-wooden-print-is-the-answer-handmade-for-uniqueness-and-character-our-wooden-prints-will-elevate-any-home-office-or-common-space-add-custom-designs-and-personalization-options-to-make-this-wall-art-a-truly-special-piece":"Lookingtoaddsomecharmandcharactertoyourspace?Our14x24”WoodenPrintistheanswer!Handmadeforuniquenessandcharacter,ourwoodenprintswillelevateanyhome,office,orcommonspace.Addcustomdesignsandpersonalizationoptionstomakethiswallartatrulyspecialpiece.","sl-retail.product.description.low-melting-point-for-easy-welding":"Lowmeltingpointforeasywelding","sl-retail.product.description.low-profile.sewn.eyelets":"Low-profilesewneyelets","sl-retail.product.description.low.profile.sewn.eyelets":"Low-profilesewneyelets","sl-retail.product.description.m-70cm-48cm-48cm-suitable-for-medium-sized-dogs-with-a-neck-circumference-of-30-42cm":"M:70cm*48cm*48cm-suitableformedium-sizeddogswithaneckcircumferenceof30~42cm","sl-retail.product.description.machine-wash":"Machinewash","sl-retail.product.description.machine-wash-the-print-doesn-t-fade":"Machinewash(theprintdoesn'tfade)","sl-retail.product.description.machine-wash-with-cold-water-and-air-dry":"Machinewashwithcoldwaterandairdry","sl-retail.product.description.machine-wash.safe":"Machine-washsafe","sl-retail.product.description.machine-washable-in-hot-water-can-be-bleached-and-dried":"Machinewashableinhotwater,canbebleachedanddried","sl-retail.product.description.machine-washable-reusable":"Machinewashableinhotwater,canbebleachedanddried","sl-retail.product.description.machine-washable-with-cold-water-gentle-cycle-and-mild-detergent":"Machinewashablewithcoldwatergentlecycleandmilddetergent.","sl-retail.product.description.made-for-fast-easy-installation-and-portability":"Madeforfast,easyinstallationandportability","sl-retail.product.description.made-from-high-grade-microfiber-leather-with-no-buttons-or-zippers-for-zero-fuss":"Madefromhigh-grade,microfiberleatherwithnobuttonsorzippersforzerofuss","sl-retail.product.description.made-from-high-grade-microfiber-material-with-a-single-zippered-top-closure-for-quick-and-easy-access":"Madefromhigh-grademicrofibermaterialwithasinglezipperedtopclosureforquickandeasyaccess","sl-retail.product.description.made-from-high-grade-microfiber-with-a-single-zippered-top-closure-for-easy-open-and-close":"Madefromhigh-grademicrofiberwithasinglezipperedtopclosureforeasyopenandclose","sl-retail.product.description.made-from-high-grade-microfiber-with-single-button-closure-that-makes-it-easy-to-open-and-close":"Madefromhigh-grademicrofiberwithsingle-buttonclosurethatmakesiteasytoopenandclose","sl-retail.product.description.made-in-usa":"MadeinUSA","sl-retail.product.description.made-in-usa-proudly-made-in-the-usa-ships-from-the-midwest":"MADEINUSA:ProudlymadeintheUSA;ShipsfromtheMidwest","sl-retail.product.description.made-just-for-you-every-order-is-produced-individually-after-the-purchase":"MADEJUSTFORYOU:Everyorderisproducedindividuallyafterthepurchase.","sl-retail.product.description.made-of-304-stainless-steel-with-special-printing-ink-for-a-shiny-result":"Madeof304stainlesssteelwithspecialprintinginkforashinyresult","sl-retail.product.description.made-of-304-stainless-steel-with-special-printing-ink-that-makes-your-print-shiny":"Madeof304stainlesssteelwithspecialprintinginkthatmakesyourprintshiny","sl-retail.product.description.made-of-304-stainless-steel-with-special-printing-ink-to-make-the-result-shiny-and-cool":"Madeof304stainlesssteelwithspecialprintinginktomaketheresultshinyandcool","sl-retail.product.description.made-of-durable-and-washable-95-polyester-and-5-spandex":"Madeofdurableandwashable95%polyesterand5%spandex","sl-retail.product.description.made-of-high-quality-1200d-nylon-fabric-for-ultimate-comfort-and-wear-resistance":"Madeofhigh-quality1200Dnylonfabricforultimatecomfortandwearresistance","sl-retail.product.description.made-of-high-quality-material-non-toxic":"Madeofhighqualitymaterial,non-toxic","sl-retail.product.description.made-of-lightweight-breathable-jersey-knit-for-the-ultimate-comfort":"Madeoflightweight,breathablejerseyknitfortheultimatecomfort","sl-retail.product.description.made-of-lightweight-material-less-than-1kgs":"Madeoflightweightmaterial,lessthan1kgs","sl-retail.product.description.made-of-lightweight-mdf-wood-easy-for-hanging-without-weighing-down-your-tree":"MadeoflightweightMDFwood,easyforhangingwithoutweighingdownyourtree.","sl-retail.product.description.made-of-polyurethane-leather-which-gives-it-a-simple-yet-classic-look":"Madeofpolyurethaneleather,whichgivesitasimpleyetclassiclook","sl-retail.product.description.made-of-white-porcelain-easy-for-hanging-without-weighing-down-your-tree":"Madeofwhiteporcelain,easyforhangingwithoutweighingdownyourtree.","sl-retail.product.description.made-with-a-lightweight-jersey-knit-fabric-that-s-breathable-and-soft-that-still-prints-vibrant-colors":"Madewithalightweightjerseyknitfabricthat’sbreathableandsoftthatstillprintsvibrantcolors","sl-retail.product.description.made-with-a-soft-lightweight-jersey-knit-that-results-in-bright-vibrant-colors":"Madewithasoft,lightweightjerseyknitthatresultsinbright,vibrantcolors","sl-retail.product.description.made-with-an-eva-outsole-for-a-lightweight-flexible-shoe":"MadewithanEVAoutsoleforalightweight,flexibleshoe","sl-retail.product.description.made-with-high-quality-polyester-fabric":"Madewithhigh-qualitypolyesterfabric","sl-retail.product.description.made-with-soft-jersey-knit-fabric":"Madewithsoftjerseyknitfabric","sl-retail.product.description.made-with-top-quality-libbey-duratuf-technology-which-strengthens-glassware-and-makes-it-more-resistant-to-both-thermal-and-mechanical-shock":"MadewithtopqualityLibbeyDuraTuftechnologywhichstrengthensglasswareandmakesitmoreresistanttoboththermalandmechanicalshock","sl-retail.product.description.made-with-top-quality-libbey-duratuff-technology-which-strengthens-glassware-and-makes-it-more-resistant-to-both-thermal-and-mechanical-shock":"MadewithtopqualityLibbeyDuraTufftechnologywhichstrengthensglasswareandmakesitmoreresistanttoboththermalandmechanicalshock","sl-retail.product.description.main-body-light-weight-breathable-and-sweat-wicking-material":"MainBody:Lightweight,breathable,andsweatwickingmaterial","sl-retail.product.description.main-material-pu-nano-gel":"Mainmaterial:PUnanogel","sl-retail.product.description.make-all-the-home-decor-dreams-come-true-with-our-rustic-10-5x36-wooden-prints-because-each-piece-is-handmade-you-ll-love-knowing-that-your-wall-art-is-unique-with-its-own-character-and-charm-no-two-products-look-the-same-upgrade-your-home-office-space-or-even-give-it-as-a-gift-to-the-lucky-recipient":"Makeallthehomedecordreamscometruewithourrustic10.5x36”WoodenPrints!Becauseeachpieceishandmade,you’llloveknowingthatyourwallartisuniquewithitsowncharacterandcharm.Notwoproductslookthesame!Upgradeyourhome,officespace,orevengiveitasagifttotheluckyrecipient.","sl-retail.product.description.make-sure-your-lugge-lasts-with-our-lugge-covers-to-protect-it-from-the-hustle-and-bustle-of-treling-our-lugge-covers-are-designed-with-ease-of-use-and-practicality-in-mind":"MakesureyourluggelastswithourLuggeCoverstoprotectitfromthehustleandbustleoftreling.OurLuggeCoversaredesignedwitheaseofuseandpracticalityinmind.","sl-retail.product.description.makeup-brush":"Makeupbrush:","sl-retail.product.description.manufactured-exclusively-with-roll-to-roll-all-over-printing":"Manufacturedexclusivelywithrolltorollall-overprinting","sl-retail.product.description.manufactured-with-washable-95-polyester-and-5-spandex":"Manufacturedwithwashable95%polyesterand5%spandex","sl-retail.product.description.mat-size-183cm-68cm-5mm":"MatSize:183cm*68cm*5mm","sl-retail.product.description.matching-aluminum-sheet-for-sublimation-print":"Matchingaluminumsheetforsublimationprint","sl-retail.product.description.material-100-ceramic":"Material:100%Ceramic","sl-retail.product.description.material-100-polyester":"Material:100%polyester","sl-retail.product.description.material-304-stainless-steel-special-printing-ink-make-the-printing-shinny-feature-eco-friendly":"MATERIAL:304StainlessSteelspecialprintinginkmaketheprintingshinny–Feature:Eco-friendly","sl-retail.product.description.material-abs-glass-oil-vinegar-spray-bottle":"Materialabsglassoilvinegarspraybottle","sl-retail.product.description.material-acrylic":"Material:Acrylic","sl-retail.product.description.material-aluminum":"Material:Aluminum","sl-retail.product.description.material-cotton":"Material:Cotton","sl-retail.product.description.material-double-wall-vacuum-stainless-steel-with-copper-lining":"Material:doublewallvacuumstainlesssteelwithcopperlining","sl-retail.product.description.material-jersey-cotton-blend":"Material:JerseyCottonBlend","sl-retail.product.description.material-nylon-hair-aluminum-alloy-plastic":"Material:NylonHair/aluminumalloy/plastic","sl-retail.product.description.material-plastic":"Material:Plastic","sl-retail.product.description.material-porcelain":"Material:porcelain","sl-retail.product.description.material-pu":"Material:PU","sl-retail.product.description.material-pvc":"Material:PVC","sl-retail.product.description.material-stainless-steel":"Material:stainlesssteel","sl-retail.product.description.material-titanium-steel":"Material:TitaniumSteel","sl-retail.product.description.material-zinc-alloy-glass":"Material:Zincalloy/glass","sl-retail.product.description.material.100.ceramic":"Material:100%Ceramic","sl-retail.product.description.material.100.cotton.canvas":"Material:100%CottonCanvas","sl-retail.product.description.materials-size-here":"Materials:size,here","sl-retail.product.description.mats-can-be-highly-effective-in-trapping-dirt-before-entering-the-house-and-reducing-the-amount-of-dust-and-dirt-that-comes-into-the-building":"Matscanbehighlyeffectiveintrappingdirtbeforeenteringthehouseandreducingtheamountofdustanddirtthatcomesintothebuilding.","sl-retail.product.description.maximum-durability":"Maximumdurability","sl-retail.product.description.measurement-10-x-3":"Measurement:10\"x3\"","sl-retail.product.description.measures-70-lx10-w":"Measures70”Lx10”W","sl-retail.product.description.measures.104.x.88":"Measures104\"x88\"","sl-retail.product.description.measures.12.5.x.8.5":"Measures12.5\"x8.5\"","sl-retail.product.description.measures.16.x.72":"Measures72\"x16\"","sl-retail.product.description.measures.16.x.90":"Measures90\"x16\"","sl-retail.product.description.measures.18.x.14":"Measures18\"x14\"","sl-retail.product.description.measures.18.x.30":"Measures18\"x30\"","sl-retail.product.description.measures.24.x.13":"Measures24\"x13\"","sl-retail.product.description.measures.24.x.17":"Measures24\"x17\"","sl-retail.product.description.measures.26.x.36":"Measures36\"x26\"","sl-retail.product.description.measures.27.x.30":"Measures27\"x30\"","sl-retail.product.description.measures.28.x.18":"Measures28\"x18\"","sl-retail.product.description.measures.30.x.20.for.standard.pillows":"Measures30\"x20\"forstandardpillows","sl-retail.product.description.measures.30.x.60":"Measures30\"x60\"","sl-retail.product.description.measures.34.x.21":"Measures34\"x21\"","sl-retail.product.description.measures.36.x.72":"Measures36\"x72\"","sl-retail.product.description.measures.38.x.22.for.standard.pillows":"Measures38\"x22\"forkingpillows","sl-retail.product.description.measures.40.x.30":"Measures40\"x30\"","sl-retail.product.description.measures.50.x.40":"Measures50\"x40\"","sl-retail.product.description.measures.50.x.84":"Measures50\"x84\"","sl-retail.product.description.measures.51.x.60":"Measures60\"x51\"","sl-retail.product.description.measures.68.x.80":"Measures80\"x68\"","sl-retail.product.description.measures.68.x.88":"Measures68\"x88\"","sl-retail.product.description.measures.68.x.92":"Measures68\"x92\"","sl-retail.product.description.measures.71.x.74":"Measures71\"x74\"","sl-retail.product.description.measures.8.5.x.6":"Measures8.5\"x6\"","sl-retail.product.description.measures.88.x.104":"Measures104\"x88\"","sl-retail.product.description.measures.88.x.88":"Measures88\"x88\"","sl-retail.product.description.memory-foam-core":"Memoryfoamcore","sl-retail.product.description.memory-foam-particle-filling":"Memoryfoamparticlefilling","sl-retail.product.description.metal-eyelets-for-a-classic-look":"Metaleyeletsforaclassiclook","sl-retail.product.description.metal-h-stand-included-for-simple-installation":"MetalHstandincludedforsimpleinstallation","sl-retail.product.description.microfiber-leather-exterior-with-mnetic-snap-closures":"Microfiberleatherexteriorwithmneticsnapclosures.","sl-retail.product.description.microfiber-leather-exterior-with-mnetic-snap-closures-for-easy-use":"Microfiberleatherexteriorwithmneticsnapclosuresforeasyuse","sl-retail.product.description.microfiber-pads":"MicrofiberPads","sl-retail.product.description.microfiber-velour-material":"Microfibervelourmaterial","sl-retail.product.description.microfiber.foam.construction":"Microfiberfoamconstruction","sl-retail.product.description.microfiber.pillow.sham":"Microfiberpillowsham","sl-retail.product.description.microfiber.printed.face.with.cream.back":"Microfiberprintedfacewithcreamback","sl-retail.product.description.microwe-safe":"Microwesafe","sl-retail.product.description.microwe-safe-so-you-can-reheat-your-forite-drinks-easily":"Microwesafesoyoucanreheatyourforitedrinkseasily","sl-retail.product.description.microwe.safe":"Microwesafe","sl-retail.product.description.middle-layer-non-woven-filter-material":"MiddleLayernon-wovenfiltermaterial","sl-retail.product.description.middle-waist":"Middlewaist","sl-retail.product.description.missing-descriptions":"Missingdescriptions","sl-retail.product.description.modestly-cut-arm-openings-with-a-sporty-racerback-design":"Modestlycutarmopeningswithasportyracerbackdesign","sl-retail.product.description.moisture-wicking-breathable-performance-fabric":"Moisturewicking,breathableperformancefabric","sl-retail.product.description.moldable-nose-wire":"Moldablenosewire","sl-retail.product.description.monofilament-hand-throwing-net":"Monofilamenthandthrowingnet","sl-retail.product.description.more-commas-plus-colons-14cm-x-5cm":"Morecommas,pluscolons:14cmX5cm","sl-retail.product.description.multifunctional-wear-as-a-neck-gaiter-bandana-headband":"Multifunctional-wearasaneckgaiter,bandana,headband,wristbandorfacecovering","sl-retail.product.description.multiple-lines-test":"MultipleLinesTest","sl-retail.product.description.net.border.white-or-yellow":"Netbordermaterialmaybewhiteoryellow","sl-retail.product.description.net.size.100-x-30":"100cmX30cm","sl-retail.product.description.net.size.150-x-50":"150cmX50cm","sl-retail.product.description.nice-tshirt":"Nicetshirt","sl-retail.product.description.nicely-sized-for-easy-coordination-with-other-small-or-large-sized-ornaments":"Nicelysizedforeasycoordinationwithothersmallorlarge-sizedornaments.","sl-retail.product.description.ninja-design-on-inside-of-shirt":"Ninjadesignontheinsideofshirt","sl-retail.product.description.no-more-white-creases-often-found-in-other-garments-our-special-printing-process-of-roll-to-roll-all-over-printing-makes-the-end-result-more-flawless-than-stamping-a-sewn-garment":"Nomorewhitecreasesoftenfoundinothergarments!Ourspecialprintingprocessofrolltorollall-overprintingmakestheendresultmoreflawlessthanstampingasewngarment","sl-retail.product.description.no-percent":"Nopercent","sl-retail.product.description.no-pill-finish-keeps-the-fleece-looking-neat":"No-pillfinishkeepsthefleecelookingneat","sl-retail.product.description.non-woven-durable-polyester-fabric":"Non-woven,durablepolyesterfabric","sl-retail.product.description.not-a-medical-device":"Notamedicaldevice","sl-retail.product.description.not-dishwasher-safe":"Notdishwashersafe","sl-retail.product.description.not-medical-device":"Notamedicaldevice","sl-retail.product.description.not.dishwasher.safe":"Notdishwashersafe","sl-retail.product.description.not.microwe.dishwasher.safe":"Notmicrowe/dishwashersafe","sl-retail.product.description.not.microwe.safe":"Notmicrowesafe","sl-retail.product.description.note":"Note:","sl-retail.product.description.note-color-in-person-may-be-different-from-what-appears-on-your-device-due-to-light-and-variations-in-screen-displays":"Note:Colorin-personmaybedifferentfromwhatappearsonyourdeviceduetolightandvariationsinscreendisplays","sl-retail.product.description.note-due-to-lighting-and-screen-display-variations-the-color-you-see-on-your-device-may-be-different-from-what-you-see-in-person":"Note:Duetolightingandscreendisplayvariations,thecoloryouseeonyourdevicemaybedifferentfromwhatyouseeinperson.","sl-retail.product.description.note-due-to-lighting-and-varying-screen-displays-the-color-of-the-tumbler-on-the-monitor-may-be-different-from-that-in-person":"Note:Duetolightingandvaryingscreendisplays,thecolorofthetumbleronthemonitormaybedifferentfromthatinperson.","sl-retail.product.description.note-the-color-seen-in-person-may-be-different-from-what-is-seen-on-your-device-due-to-lighting-and-variations-in-screen-display":"Note:Thecolorseeninpersonmaybedifferentfromwhatisseenonyourdeviceduetolightingandvariationsinscreendisplay.","sl-retail.product.description.oba-optical-brightening-ent-free":"OBA(opticalbrighteningent)free","sl-retail.product.description.officially.licensed":"Officiallylicensed","sl-retail.product.description.officially.licensed.designed.and.printed.in.the.u.s.a.":"Officiallylicensed,designed,andprintedintheU.S.A.","sl-retail.product.description.on-the-hunt-for-the-perfect-custom-t-shirt-you-re-in-the-right-place-discover-a-beautiful-printed-t-shirt-in-the-design-of-your-choice-with-incredibly-soft-fabric-and-a-flattering-cut-to-complete-any-look-our-women-s-aop-shirt-can-be-easily-dressed-up-or-down-depending-on-your-mood-or-outing-so-make-sure-you-he-enough-in-your-closet-to-create-variety":"Onthehuntfortheperfectcustomt-shirt?You’reintherightplace!Discoverabeautifulprintedt-shirtinthedesignofyourchoice,withincrediblysoftfabricandaflatteringcuttocompleteanylook.OurWomen’sAOPShirtcanbeeasilydressedupordowndependingonyourmoodorouting,somakesureyouheenoughinyourclosettocreatevariety.","sl-retail.product.description.one-picture-black-brush":"Onepicture,blackbrush","sl-retail.product.description.one-screwdriver-and-a-few-spare-parts-included":"Onescrewdriverandafewsparepartsincluded","sl-retail.product.description.one-sided-printing-only":"Onesidedprintingonly","sl-retail.product.description.one-size":"Onesize","sl-retail.product.description.one-size-fits-all":"Onesizefitsall","sl-retail.product.description.one-size-fits-most":"OneSizeFitsMost","sl-retail.product.description.one.fade.resistant.print":"One-side,fade-resistantprint","sl-retail.product.description.one.side.print":"One-sideprint","sl-retail.product.description.one.side.print.with.hemmed.edges":"One-sideprintwithhemmededges","sl-retail.product.description.open.front.pockets":"Openfrontpockets","sl-retail.product.description.our-20-oz-straight-glittering-tumbler-will-be-your-next-forite-thing-upgrade-every-bevere-with-color-shine-and-fun-in-this-eco-friendly-cylindrical-vessel-that-makes-it-easy-to-enjoy-grab-your-drinks-and-sip-on-them-in-the-comfort-of-your-home-backyard-or-even-on-the-go":"Our20oz.StraightGlitteringTumblerwillbeyournextforitething!Upgradeeverybeverewithcolor,shine,andfuninthiseco-friendly,cylindricalvesselthatmakesiteasytoenjoy.Grabyourdrinksandsipontheminthecomfortofyourhome,backyard,orevenonthego.","sl-retail.product.description.our-24x17-5-wooden-print-is-the-perfect-piece-for-any-home-upgrades-with-its-own-unique-grain-and-character-you-ll-be-able-to-beautify-any-space-the-best-part-you-can-choose-your-custom-designs-to-make-each-product-special-add-a-personalization-touch-for-the-ultimate-experience":"Our24x17.5”WoodenPrintistheperfectpieceforanyhomeupgrades!Withitsownuniquegrainandcharacter,you’llbeabletobeautifyanyspace.Thebestpart?Youcanchooseyourcustomdesignstomakeeachproductspecial.Addapersonalizationtouchfortheultimateexperience.","sl-retail.product.description.our-24x24-wooden-print-is-the-perfect-gift-to-yourself-family-and-friends-each-item-is-handmade-so-you-ll-never-find-any-two-that-are-exactly-alike-its-unique-charm-and-character-make-this-a-special-piece-to-adorn-your-home-office-or-wherever-you-please-add-a-personalization-factor-to-make-it-extra-sentimental":"Our24x24”WoodenPrintistheperfectgifttoyourself,family,andfriends.Eachitemishandmade,soyou’llneverfindanytwothatareexactlyalike!Itsuniquecharmandcharactermakethisaspecialpiecetoadornyourhome,office,orwhereveryouplease.Addapersonalizationfactortomakeitextrasentimental.","sl-retail.product.description.our-premium-bedding-set-is-crafted-with-an-ultra-soft-polyester-fabric-outer-shell-and-a-hypo-allergenic-cotton-lining-this-blend-makes-for-a-comfortable-and-breathable-experience-perfect-for-year-round-use-high-quality-print-ensures-long-lasting-vibrant-colors":"Ourpremiumbeddingsetiscraftedwithanultra-softpolyesterfabricoutershellandahypo-allergeniccottonlining.Thisblendmakesforacomfortableandbreathableexperience,perfectforyear-rounduse.High-qualityprintensureslong-lasting,vibrantcolors","sl-retail.product.description.out-with-the-old-in-with-the-new-our-fashionable-vertical-women-s-leather-wallet-is-a-must-he-in-any-closet-and-offers-more-space-to-store-your-essentials":"Outwiththeold,inwiththenew!OurfashionableverticalWomen'sLeatherWalletisamust-heinanyclosetandoffersmorespacetostoreyouressentials.","sl-retail.product.description.outdoor-and-indoor-use":"OutdoorandIndoorUse","sl-retail.product.description.outer-layer-hydrophobic-water-resistant-polyester-fabric":"OuterLayerhydrophobicwaterresistantpolyesterfabric","sl-retail.product.description.packe-size-700-x-150-x-150-mm":"PackeSize:700x150x150mm","sl-retail.product.description.patented-design-solid-front-construction-for-a-longer-lasting-canvas":"Patenteddesign;solid-frontconstructionforalonger-lastingcanvas","sl-retail.product.description.pendant-material-metal":"Pendantmaterial:Metal","sl-retail.product.description.perfect-corners":"Perfectcorners","sl-retail.product.description.perfect-for-any-deck-patio-porch-veranda-and-entryway-and-extend-a-warm-welcome-to-all-who-enter-your-home":"Perfectforanydeck,patio,porch,veranda,andentrywayandextendawarmwelcometoallwhoenteryourhome!","sl-retail.product.description.perfect-for-christmas-trees-wreaths-doorways-and-more":"PerfectforChristmastrees,wreaths,doorways,andmore.","sl-retail.product.description.perfect-for-hanging-on-the-christmas-tree-as-they-don-t-weigh-it-down":"PerfectforhangingontheChristmastree,astheydon’tweighitdown.","sl-retail.product.description.perfect-for-hot-beveres-such-as-coffee-chocolate-and-tea":"Perfectforhotbeveressuchascoffee,chocolateandtea","sl-retail.product.description.perfect-for-indoor-or-outdoor-use":"Perfectforindoororoutdooruse","sl-retail.product.description.perfect-for-snuggling-while-watching-tv-on-the-couch-relaxing-on-a-sofa-or-reading-in-bed":"PerfectforsnugglingwhilewatchingTVonthecouch,relaxingonasofa,orreadinginbed.","sl-retail.product.description.perfect-for-storing-and-organizing-laundry-toys-books-and-other-household-goods":"Perfectforstoringandorganizinglaundry,toys,books,andotherhouseholdgoods","sl-retail.product.description.perfect-for-writing-sketching-journaling-and-to-do-lists":"Perfectforwriting,sketching,journaling,andto-dolists","sl-retail.product.description.perfect-size-2-4-x-3-3":"Perfectsize:~2.4\"x3.3\"","sl-retail.product.description.perfect-size-2-7-x-2-8":"Perfectsize:~2.7\"x2.8\"","sl-retail.product.description.perfect-size-2-9-x-3-3":"Perfectsize:~2.9\"x3.3\"","sl-retail.product.description.perfect-size-3-1-x-3-1":"Perfectsize:~3.1\"x3.1\"","sl-retail.product.description.perfectly-sized-to-make-it-easy-to-take-on-the-go-or-to-throw-in-your-b":"Perfectlysizedtomakeiteasytotakeonthegoortothrowinyourb","sl-retail.product.description.pipe-length-20m":"Pipelength:20m","sl-retail.product.description.place-the-item-in-the-proper-position-and-it-won-t-slip":"Placetheitemintheproperpositionanditwon'tslip.","sl-retail.product.description.plastic.button-up.closure":"Plasticbutton-upclosure","sl-retail.product.description.please-note-logo-ts-cannot-be-added-to-this-product":"Pleasenote,logotscannotbeaddedtothisproduct","sl-retail.product.description.please-note-the-item-must-be-charged-prior-to-first-use-charge-time-varies-by-device-min-3-5-hrs":"Pleasenote,theitemmustbechargedpriortofirstuse(chargetimevariesbydevice,min3.5hrs.)","sl-retail.product.description.pleated-covering-adjusts":"Pleatedcoveringthatadjustsbasedonsizeofface","sl-retail.product.description.pleated-covering-that-adjusts-based-on-size-of-face":"Pleatedcoveringthatadjustsbasedonsizeofface","sl-retail.product.description.plugs-in-to-heat-food":"Plugsintoheatfood","sl-retail.product.description.pocket-for-filter-filter-not-included":"Pocketforfilter(*filternotincluded)","sl-retail.product.description.poles-not-included":"Polesarenotincluded","sl-retail.product.description.poly-cotton-blend-canvas-with-satin-finish":"Poly/cottonblendcanvaswithsatinfinish","sl-retail.product.description.polyester-and-spandex-blend":"PolyesterandSpandexblend","sl-retail.product.description.polyester-spandex-blend":"Polyester/SpandexBlend","sl-retail.product.description.polyester-sublimated-exterior-with-soft-microfiber-interior":"Polyestersublimatedexteriorwithsoftmicrofiberinterior","sl-retail.product.description.polyester.fabric.cream.laminate.lining":"Polyesterfabricwithcream-laminatelining","sl-retail.product.description.polyurethane-nano-gel":"Polyurethanenanogel.","sl-retail.product.description.portable-and-convenient":"Portableandconvenient","sl-retail.product.description.powder-coated-exterior-for-a-classy-finish":"Powder-coatedexteriorforaclassyfinish","sl-retail.product.description.power-40-w":"Power:40W","sl-retail.product.description.power-rechargeable-lithium-polymer-battery-input-dc-5v-output-3-7v-capacity-430-mah":"Power:rechargeablelithium-polymerbattery(input:DC5V,Output:3.7V,Capacity:430mAh)","sl-retail.product.description.power-technology-rechargeable-lithium-polymer-battery-input-dc-5v-output-3-7v-capacity-430-mah":"Power/Technology:RechargeableLithiumPolymerbattery;Input:DC5V,Output:3.7V,Capacity:430mAh","sl-retail.product.description.powered-by-4-x-aa-batteries-not-included-or-dc-6v-600ma-power-adaptor-not-included":"PoweredBy:4xAAbatteries(notincluded)orDC6V600mApoweradaptor(notincluded).","sl-retail.product.description.pp-plastic-screw-on-lid-with-convenient-ergonomic-handle-for-easy-carry":"PPPlasticscrew-onlidwithconvenientergonomichandleforeasycarry","sl-retail.product.description.prank":"Prank","sl-retail.product.description.prank-in-a-box":"Prankinabox","sl-retail.product.description.prank-scorpion-in-a-box":"PrankScorpioninabox","sl-retail.product.description.prank-spider":"Prankspider","sl-retail.product.description.premium-fabric-offers-unmatched-comfort-and-breath-ability-while-remaining-strong-and-durable-for-everyday-use":"Premiumfabricoffersunmatchedcomfortandbreath-abilitywhileremainingstronganddurableforeverydayuse.","sl-retail.product.description.premium-polyester-material-with-ultra-high-resolution-printing":"Premiumpolyestermaterialwithultrahighresolutionprinting","sl-retail.product.description.premium-polyester-print-beautiful-color-vibrancy":"Premiumpolyesterprintforbeautifulcolorvibrancy","sl-retail.product.description.preshrunk-and-machine-wash-safe":"Preshrunkandmachine-washsafe","sl-retail.product.description.preshrunk-fabric-for-hassle-free-washing":"Preshrunkfabricforhassle-freewashing","sl-retail.product.description.preshrunk.and.machine-wash.safe":"Preshrunkandmachine-washsafe","sl-retail.product.description.press-in-drink-thru-lid":"Press-in,drink-thrulid","sl-retail.product.description.printed-in-the-usa":"PrintedintheUSA","sl-retail.product.description.printed-in-usa":"PrintedinUSA","sl-retail.product.description.printed-on-both-sides":"Printedonbothsides","sl-retail.product.description.printed-on-both-sides-which-makes-them-look-awesome-from-any-angle":"Printedonbothsides,whichmakesthemlookawesomefromanyangle.","sl-retail.product.description.printed.face.with.blank.back":"Printedfacewithblankback","sl-retail.product.description.printed.face.with.envelop.closure":"Printedfacewithenvelopclosure","sl-retail.product.description.printed.face.with.non.skid.backing":"Printedfacewithnon-skidbacking","sl-retail.product.description.printed.in.the.u.s.a.":"ProductsareproudlyprintedintheUnitedStates","sl-retail.product.description.printed.microfiber.top.with.white.back":"Printedmicrofibertopwithwhiteback","sl-retail.product.description.printed.on.200.gsm.paper":"Printedon200GSMpaper","sl-retail.product.description.printed.top.surface.with.white.back":"Printedtopsurfacewithwhiteback","sl-retail.product.description.pro":"pro","sl-retail.product.description.product-details":"productDetails","sl-retail.product.description.product-dimensions-3-7-x4-7-x3-2-height-x-width-x-diameter":"ProductDimensions:3.7”x4.7″x3.2″(heightxwidthxdiameter)","sl-retail.product.description.product-size-10-h-x-2-75-dia":"ProductSize:10\"hx2.75\"dia.","sl-retail.product.description.product-size-cm-23-6-5-11":"ProductSize:approx23cmX6.5cmX11cm","sl-retail.product.description.product-specifications-glass-pattern-diameter-2cm":"Productspecifications:Glasspatterndiameter2cm","sl-retail.product.description.products-are-proudly-printed-in-the-united-states":"ProductsareproudlyprintedintheUnitedStates","sl-retail.product.description.prominent-waistband-hem":"Prominentwaistbandhem","sl-retail.product.description.pronounced-sleeve-cuffs":"Pronouncedsleevecuffs","sl-retail.product.description.protect-your-seats-from-spills-tearing-and-fading-with-our-2-piece-car-seat-cover-set-ideal-for-families-road-trips-and-everyday-use-to-keep-your-car-looking-and-smelling-brand-new":"Protectyourseatsfromspills,tearing,andfadingwithour2-pieceCarSeatCoverSet.Idealforfamilies,roadtrips,andeverydayusetokeepyourcarlooking(andsmelling)brandnew.","sl-retail.product.description.proudly-printed-in-the-united-states":"ProudlyprintedintheUnitedStates","sl-retail.product.description.provides-spinal-traction":"Providesspinaltraction","sl-retail.product.description.push-in-sipper-lid":"Push-insipperlid","sl-retail.product.description.qualirint-on-car-seat-covers-will-not-fade-for-long-lasting-reliable-protection":"Qualirintoncarseatcoverswillnotfadeforlong-lasting,reliableprotection","sl-retail.product.description.quality-long-lasting-print-on-shoes-will-not-fade":"Quality,long-lastingprintonshoeswillnotfade","sl-retail.product.description.quantity-1pc":"Quantity:1pc","sl-retail.product.description.quartz-frame-clock-with-a-plastic-face-cover":"Quartzframeclockwithaplasticfacecover","sl-retail.product.description.quick-and-easy-installation-on-most-cars-with-no-tools-required":"Quickandeasyinstallationonmostcarswithnotoolsrequired","sl-retail.product.description.quiet-and-convenient":"Quietandconvenient","sl-retail.product.description.quilt-is-70-x-8":"Quiltis70x8\"","sl-retail.product.description.quilt-is-75-x-85":"Quiltis75\"x85\"","sl-retail.product.description.quilt-is-80-x-90":"Quiltis80\"x90\"","sl-retail.product.description.quilt-is-90-x-100":"Quiltis90x100\"","sl-retail.product.description.quilt-is-91-x-102":"Quiltis91\"x102\"","sl-retail.product.description.ready-to-hang-includes-sawtooth-hangers-for-easy-wall-application-and-alignment":"READYTOHANG:Includessawtoothhangersforeasywallapplicationandalignment","sl-retail.product.description.ready-to-hang-on-your-tree-wreath-or-doorway-as-it-comes-with-an-attached-loop":"Readytohangonyourtree,wreath,ordoorway,asitcomeswithanattachedloop.","sl-retail.product.description.ready-to-hang-or-display-with-enclosed-back-hanging-hardware-and-easel":"Readytohangordisplaywithenclosedback,hanginghardware,andeasel","sl-retail.product.description.ready-to-hang-with-enclosed-back-and-hardware":"Readytohangwithenclosedbackandhardware","sl-retail.product.description.ready-to-hang-with-finished-back-and-hardware":"Readytohangwithfinishedbackandhardware","sl-retail.product.description.rechargeable-battery":"RechargeableBattery","sl-retail.product.description.red-hello":"Red.hello.:","sl-retail.product.description.reinforced.rib-knit.lycra.cuffs.for.durability":"Reinforcedrib-knitLycra®cuffsfordurability","sl-retail.product.description.reinforced.three-snap.closure":"Reinforcedthree-snapclosure","sl-retail.product.description.relaxing-days-wouldn-t-be-the-same-without-our-soft-and-comfy-sweatpants":"Relaxingdayswouldn'tbethesamewithoutoursoftandcomfysweatpants.","sl-retail.product.description.removable-filter-for-easy-cleaning":"Removablefilterforeasycleaning","sl-retail.product.description.removable-vinyl-sticker-with-glossy-finish":"RemovableVinylStickerwithGlossyFinish","sl-retail.product.description.rhinestone":"Rhinestone","sl-retail.product.description.rib-knit-set-in-collar":"Rib-knitset-incollar","sl-retail.product.description.rib-knit.set-in.collar":"Rib-knitset-incollar","sl-retail.product.description.rib.knit.cuffs":"Ribknitcuffs","sl-retail.product.description.ribbed-fabric-cotton-spandex":"RibbedFabric(95%Cotton,5%Spandex)","sl-retail.product.description.ribbed.and.double.stitched.collar":"Ribbedanddoublestitchedcollar","sl-retail.product.description.ribbed.and.double.stitched.collar.and.armholes":"Ribbedanddoublestitchedcollarandarmholes","sl-retail.product.description.ribbed.and.double.stitched.collar.and.sleeve":"Ribbedanddoublestitchedcollarandsleeve","sl-retail.product.description.ring-material-aluminum":"RingMaterial:Aluminum","sl-retail.product.description.roll-to-roll-all-over-printing-for-a-seamless-finish":"Rolltorollall-overprintingforaseamlessfinish","sl-retail.product.description.roomy-interior-features-eight-card-slots-one-zipper-pocket-one-phone-pocket-and-two-full-length-pockets":"Roomyinteriorfeatureseightcardslots,onezipperpocket,onephonepocket,andtwofull-lengthpockets","sl-retail.product.description.rubber-foot-pads-included":"Rubberfootpadsincluded","sl-retail.product.description.rubber-leather-detergent-frosted-granules":"Material:Rubber,LeatherDetergent,FrostedGranules","sl-retail.product.description.running-shorts-with-inside-liner":"RunningShortswithInsideLiner","sl-retail.product.description.runs-smaller-than-usual-suggested-to-size-up":"Runssmallerthanusual,suggestedtosizeup","sl-retail.product.description.s-55cm-38cm-38cm-suitable-for-small-dogs-with-a-neck-circumference-of-20-30cm":"S:55cm*38cm*38cm-suitableforsmalldogswithaneckcircumferenceof20~30cm","sl-retail.product.description.safe-and-quick-to-trim-and-file-nails":"Safeandquicktotrimandfilenails","sl-retail.product.description.safety-material-wooden-box-plastic-insects":"Safetymaterial:woodenbox,plasticinsects.","sl-retail.product.description.same-description-one":"Samedescriptionone","sl-retail.product.description.same-description-three":"Samedescriptionthree","sl-retail.product.description.same-description-two":"Samedescriptiontwo","sl-retail.product.description.satin-label":"Satinlabel","sl-retail.product.description.satin.label":"Satinlabel","sl-retail.product.description.say-goodbye-to-white-creases-that-are-common-in-similar-garments-thanks-to-our-unique-process-of-roll-to-roll-all-over-printing-rather-than-stamping-a-sewn-garment":"Saygoodbyetowhitecreasesthatarecommoninsimilargarmentsthankstoouruniqueprocessofrolltorollall-overprintingratherthanstampingasewngarment","sl-retail.product.description.scary-box-with-terrible-artificial-bug-inside":"Scarybox:scaryboxwithterribleartificialbuginside.","sl-retail.product.description.scorpion-or-spider":"ScorpionorSpider","sl-retail.product.description.seamless-breathable-moisture-wicking-material":"Seamless,breathable,moisture-wickingmaterial","sl-retail.product.description.seat-dimensions-27-5-l-x-19-w-x-2-pack":"Seatdimensions:27.5\"(L)x19\"(W)x2-Pack","sl-retail.product.description.self-fabric.closure.with.d-ring.slider.and.tuck-in.strap":"Self-fabricclosurewithD-ringsliderandtuck-instrap","sl-retail.product.description.shape-bell":"Shape:Bell","sl-retail.product.description.shape-christmas-tree-shape":"Shape:Christmastreeshape","sl-retail.product.description.shape-cone":"SHAPE:cone","sl-retail.product.description.shape-cylindrical":"SHAPE:cylindrical","sl-retail.product.description.shape-oval":"Shape:Oval","sl-retail.product.description.shape-round":"Shape:Round","sl-retail.product.description.shape-snowflake":"Shape:Snowflake","sl-retail.product.description.ships-rolled-in-a-tube":"Shipsrolledinatube","sl-retail.product.description.shoulder-hem-is-folded-and-you-can-easily-extend-the-slit-design-for-the-head":"Shoulderhemisfolded,andyoucaneasilyextendtheslitdesignforthehead","sl-retail.product.description.side.zippered.main.compartment":"Side-zipperedmaincompartment","sl-retail.product.description.simple-arm-openings-and-a-sporty-racerback-dress-style-that-makes-it-easy-for-anyone-to-wear":"Simplearmopeningsandasportyracerbackdressstylethatmakesiteasyforanyonetowear","sl-retail.product.description.single-capacity-100ml":"Singlecapacity100ml","sl-retail.product.description.single-layer-durable-polyester-cloth-face-covering":"Singlelayer,durablepolyesterclothfacecovering","sl-retail.product.description.size":"Size:","sl-retail.product.description.size-1":"size1","sl-retail.product.description.size-10-h-x-2-75-dia":"Size:10\"hx2.75\"dia","sl-retail.product.description.size-11oz":"Size:11oz","sl-retail.product.description.size-15cm":"Size:15cm","sl-retail.product.description.size-17-52-x-7-87":"Size:17.52\"x7.87\"","sl-retail.product.description.size-2":"size2","sl-retail.product.description.size-23-5cm-x-17-5cm-x-11cm":"Size:23.5cmX17.5cmX11cm","sl-retail.product.description.size-3":"size3","sl-retail.product.description.size-30cm-30cm-5cm":"Size:30cmx30cmx5cm","sl-retail.product.description.size-32-1-w-x-29-2-l":"Size:32.1\"Wx29.2\"L","sl-retail.product.description.size-33-1-w-x-45-7-l":"Size:33.1\"Wx45.7\"L","sl-retail.product.description.size-4":"size4","sl-retail.product.description.size-4-13-l-x-1-02-w-x-8-31-h-weight-7-5-oz":"Size:4.13\"(L)x1.02\"(W)x8.31\"(H).Weight:7.5oz.","sl-retail.product.description.size-40cm-50cm-60cm-70cm":"Size:40cm,50cm,60cm,70cm","sl-retail.product.description.size-41-4-w-x-49-3-l":"Size:41.4\"Wx49.3\"L","sl-retail.product.description.size-5":"size5","sl-retail.product.description.size-5-x-2-75-pleated-folded":"Size:5\"\"X2.75\"\"(pleated/folded)","sl-retail.product.description.size-5-x-5-75":"Size:5\"\"X5.75\"\"","sl-retail.product.description.size-5cm-x-6cm-x-7-cm":"Size:5cmX6cmx7Cm","sl-retail.product.description.size-6":"size6","sl-retail.product.description.size-7":"size7","sl-retail.product.description.size-7-x-3-5-pleated-folded":"Size:7\"\"X3.5\"\"(pleated/folded)","sl-retail.product.description.size-7-x-3.5":"Finishedsize:7\"X3.5\"","sl-retail.product.description.size-7-x-6-25":"Size:7\"X6.25\"","sl-retail.product.description.size-7cm-2.5cm-1.5cm":"Size:7cmX2.5cmX1.5cm","sl-retail.product.description.size-8":"size8","sl-retail.product.description.size-9":"size9","sl-retail.product.description.size-9.1-6.1-6.5-cm":"Size:9.1*6.1*6.5cm","sl-retail.product.description.size-medium":"Size:medium","sl-retail.product.description.size-medium-height-21-65-55cm-diameter-15-75-40cm":"Size:Medium(Height:21.65”/55cm,Diameter:15.75”/40cm)","sl-retail.product.description.size-of-brushes-around-13-15cm-5-12-5-9in":"Sizeofbrushes:around13-15cm/5.12-5.9in","sl-retail.product.description.size-small":"Size:small","sl-retail.product.description.size-small-height-17-72-45cm-diameter-13-78-35cm":"Size:Small(Height:17.72”/45cm,Diameter:13.78”/35cm)","sl-retail.product.description.size.11oz":"Size:11oz","sl-retail.product.description.sleek.front.zip.up":"Sleekfrontzip-up","sl-retail.product.description.sleeve-length-long-sleeve":"Sleevelength:Longsleeve","sl-retail.product.description.slim-fit":"SlimFit","sl-retail.product.description.small-but-mighty-our-mini-bifold-wallet-is-the-perfect-slimline-accessory-for-every-lifestyle-you-d-be-surprised-by-how-much-it-can-carry-without-the-added-bulk-and-best-of-all-it-s-made-to-last":"Smallbutmighty,ourMiniBifoldWalletistheperfectslimlineaccessoryforeverylifestyle.You'dbesurprisedbyhowmuchitcancarrywithouttheaddedbulk,andbestofall,it'smadetolast.","sl-retail.product.description.smooth-comfortable-fabric-in-foot-bed":"Smooth,comfortablefabricinfootbed","sl-retail.product.description.snaps-at-inseam-for-easy-dressing-and-diapering":"Snapsatinseamforeasydressinganddiapering","sl-retail.product.description.soft":"soft","sl-retail.product.description.soft-and-comfortable-to-wear":"Softandcomfortabletowear","sl-retail.product.description.soft-fleece-yarns-create-a-warmer-softer-fleece":"Softfleeceyarnscreateawarmer,softerfleece","sl-retail.product.description.soft-inner-lining-for-comfort":"Softinnerliningforcomfort","sl-retail.product.description.soft-material-makes-it-easy-to-wear":"Softmaterialmakesiteasytowear","sl-retail.product.description.soft-polyester-blend":"Soft,polyesterblend","sl-retail.product.description.soft-polyester-material-with-shiny-gloss-finish":"Softpolyestermaterialwithshinyglossfinish","sl-retail.product.description.soft-signature-cotton-blend":"Softsignaturecottonblend","sl-retail.product.description.soft.lightweight.microfiber.fabric":"Soft,lightweightmicrofiberfabric","sl-retail.product.description.soft.signature.cotton.blend":"Softsignaturecottonblend","sl-retail.product.description.specification-diameter-4cm-height-17-5cm":"Specificationdiameter4cmheight17.5cm","sl-retail.product.description.spider-in-a-box":"Spiderinabox","sl-retail.product.description.spins-at-500-rpm":"Spinsat~500RPM","sl-retail.product.description.spray-diameter-60-cm":"Spraydiameter:~60cm","sl-retail.product.description.spray-settings":"Fivespraysettings","sl-retail.product.description.spun.polyester.exterior.black.laminate.interior":"Spunpolyesterexteriorandblacklaminateinterior","sl-retail.product.description.spun.polyester.material.black.laminate.interior":"Spunpolyestermaterialwithblacklaminateinterior","sl-retail.product.description.stars-other-variants-test":"StarsOthervariantstest","sl-retail.product.description.stay-cool-and-stylish-in-our-women-s-racerback-dress-when-the-sun-decides-to-shine-our-dress-is-beautiful-versatile-and-perfect-for-many-occasions-the-best-part-it-can-also-double-as-a-swimsuit-cover-up-for-when-you-visit-the-pool-or-the-beach":"StaycoolandstylishinourWomen’sRacerbackDresswhenthesundecidestoshine!Ourdressisbeautiful,versatile,andperfectformanyoccasions.Thebestpart?Itcanalsodoubleasaswimsuitcover-upforwhenyouvisitthepoolorthebeach!","sl-retail.product.description.stays-dust-and-scratch-free-thanks-to-resistant-durable-surfaces":"Staysdustandscratch-freethankstoresistant,durablesurfaces","sl-retail.product.description.stays-protected-with-dust-resistant-and-anti-scratch-surfaces":"Staysprotectedwithdust-resistantandanti-scratchsurfaces","sl-retail.product.description.step-up-your-water-drinking-game-and-make-it-fun-with-our-light-up-water-bottle":"StepupyourwaterdrinkinggameandmakeitfunwithourLightUpWaterBottle!","sl-retail.product.description.strong-and-sturdy":"StrongandSturdy","sl-retail.product.description.sturdy-cloth-handles-for-easy-carrying":"Sturdyclothhandlesforeasycarrying","sl-retail.product.description.sturdy-cloth-handles-for-easy-transport":"Sturdyclothhandlesforeasytransport","sl-retail.product.description.sturdy-steel-frame-with-reinforced-edges-and-corners-provide-reliable-strength-and-increased-stability":"Sturdysteelframewithreinforcededgesandcornersprovidereliablestrengthandincreasedstability","sl-retail.product.description.style-details-printing":"Styledetails:Printing","sl-retail.product.description.style-european-and-american":"Style:EuropeanandAmerican","sl-retail.product.description.style-hedging":"Style:Hedging","sl-retail.product.description.style-unisex":"Style:Unisex","sl-retail.product.description.stylish-design-adds-a-touch-of-flair-to-your-daily-accessories":"Stylishdesignaddsatouchofflairtoyourdailyaccessories","sl-retail.product.description.stylish-floating-frames-made-from-recycled-materials":"Stylishfloatingframesmadefromrecycledmaterials","sl-retail.product.description.suitable-for-all-activities-including-the-shower-swimming-and-more":"Suitableforallactivities,includingtheshower,swimming,andmore","sl-retail.product.description.suitable-indoor-outdoor-beach-venues":"Suitableforindoor,outdoor,orbeachvenues","sl-retail.product.description.super-gel-formula-washable-reusable-for-unlimited-potential-use":"Supergelformula,washable,reusableforunlimitedpotentialuse.","sl-retail.product.description.super-soft-and-silky-smooth":"Supersoftandsilkysmooth","sl-retail.product.description.super.premium.sherpa.fleece":"Supersoft,premiumsherpafleece","sl-retail.product.description.super.soft.100.ring-spun.cotton":"Supersoft,100%ring-spuncotton","sl-retail.product.description.super.soft.coral.fleece":"Supersoft,coralfleece","sl-retail.product.description.tless.details.printed.inside":"Tless,detailsprintedinside","sl-retail.product.description.tless.label":"Tlesslabel","sl-retail.product.description.tailored-cut-with-v-neck-collar-line":"Tailoredcutwithv-neckcollarline","sl-retail.product.description.take-your-forite-bevere-anywhere-you-go-with-our-30oz-tumblers":"Takeyourforitebevereanywhereyougowithour30ozTumblers!","sl-retail.product.description.take-your-forite-bevere-anywhere-you-go-with-our-contour-vacuum-bottle":"TakeyourforitebevereanywhereyougowithourContourVacuumBottle!","sl-retail.product.description.taped-neck-shoulders-comfort-style":"Tapedneckandshouldersforcomfortandstyle","sl-retail.product.description.tesgx":"tesgx","sl-retail.product.description.textured-for-strong-grip-and-stability":"Texturedforstronggripandstability","sl-retail.product.description.thanks-to-advanced-3d-digital-printing-technology-the-ime-payoff-vivid-and-the-color-payoff-is-bright-and-strong":"Thankstoadvanced3Ddigitalprintingtechnology,theimepayoffvividandthecolorpayoffisbrightandstrong","sl-retail.product.description.the-advanced-3d-digital-printing-technology-makes-the-ime-is-vivid-and-the-color-bright":"Theadvanced3Ddigitalprintingtechnologymakestheimeisvividandthecolorbright","sl-retail.product.description.the-diamond-stitched-pattern-gives-a-luxurious-feel-that-is-cozy-and-breathable-perfect-for-all-year-round-use":"Thediamondstitchedpatterngivesaluxuriousfeelthatiscozyandbreathable,perfectforallyearrounduse.","sl-retail.product.description.the-print-on-briefs-is-unable-to-fade":"Theprintonbriefsisunabletofade","sl-retail.product.description.the-tape-can-be-washed-and-reused-for-more-than-600-times":"Thetapecanbewashedandreusedformorethan600times.","sl-retail.product.description.the-way-you-consume-your-beveres-has-just-gotten-a-lot-more-interesting-thanks-to-our-20-oz-cone-glittering-tumblers-on-the-go-at-home-or-anywhere-you-can-think-of-this-eco-friendly-glittering-tumbler-adds-color-and-shine-for-an-upgrade-from-an-ere-cup-enjoy-it-yourself-and-get-some-for-your-friends-too":"Thewayyouconsumeyourbevereshasjustgottenalotmoreinterestingthankstoour20oz.ConeGlitteringTumblers!Onthego,athome,oranywhereyoucanthinkof,thiseco-friendlyGlitteringTumbleraddscolorandshineforanupgradefromanerecup.Enjoyityourselfandgetsomeforyourfriends,too!","sl-retail.product.description.these-are-a-test-dinosaurs":"Theseareatestdinosaurs","sl-retail.product.description.thickness-0-045in-1-14mm":"Thickness:0.045in(1.14mm)","sl-retail.product.description.thickness-0-09in-2-29mm":"Thickness:0.09in(2.29mm)","sl-retail.product.description.thickness-0-125in-3-17mm":"Thickness:0.125in(3.17mm)","sl-retail.product.description.thickness-0-5in-1-27cm":"Thickness:0.5in(1.27cm)","sl-retail.product.description.thickness-2mm":"Thickness:2mm","sl-retail.product.description.thickness-general":"Thickness:General","sl-retail.product.description.thin-breathable-polyester-blend":"Thin,breathable,polyesterblend","sl-retail.product.description.this-is-white":"Thisiswhite","sl-retail.product.description.this-mat-is-safe-for-indoor-or-outdoor-use":"Thismatissafeforindoororoutdooruse.","sl-retail.product.description.this-product-has-color-and-size-variants":"ThisproducthasColorandSizevariants","sl-retail.product.description.this-product-has-color-variants":"ThisproducthasColorvariants","sl-retail.product.description.this-product-has-letter-size-variants":"ThisproducthasLetterSizevariants","sl-retail.product.description.this-product-has-no-variants":"Thisproducthasnovariants","sl-retail.product.description.this-product-has-numeric-size-variants":"ThisproducthasNumericSizevariants","sl-retail.product.description.this-set-includes":"Thissetincludes:","sl-retail.product.description.this-set-includes-1-one-quilt-size-details-with-a-luxurious-diamond-stitched-pattern-brings-beauty-and-elegance-to-the-bedroom-and-2-two-pillow-covers-with-matching-one-sided-printing-and-seamless-dual-flap-closure-pillow-inserts-not-included":"Thissetincludes:1.onequilt(sizedetails)withaluxuriousdiamondstitchedpatternbringsbeautyandelegancetothebedroom,and2.twopillowcoverswithmatchingone-sidedprintingandseamlessdualflapclosure.PillowinsertsNOTincluded","sl-retail.product.description.this-unique-women-s-trifold-wallet-is-made-with-organization-and-durability-in-mind-don-t-let-its-size-fool-you-it-packs-a-punch-when-it-comes-to-utility-and-accessibility":"ThisuniqueWomen'sTrifoldWalletismadewithorganizationanddurabilityinmind.Don'tletitssizefoolyou-itpacksapunchwhenitcomestoutilityandaccessibility.","sl-retail.product.description.thoughtfully-designed-to-fit-most-vehicles":"Thoughtfullydesignedtofitmostvehicles","sl-retail.product.description.trifold-design-conveniently-tucks-away-into-even-the-smallest-pockets-making-it-handy-for-everyday-use":"Trifolddesignconvenientlytucksawayintoeventhesmallestpockets,makingithandyforeverydayuse","sl-retail.product.description.tunneled.elastic.waistband":"Tunneledelasticwaistband","sl-retail.product.description.two-brush":"Twobrush","sl-retail.product.description.two-piece.waistband":"Two-piecewaistband","sl-retail.product.description.two-pieces-of-merged-design-on-the-front-and-back-of-the-briefs":"Twopiecesofmergeddesignonthefrontandbackofthebriefs","sl-retail.product.description.two-separate-compartments":"Twoseparatecompartments","sl-retail.product.description.two-side-hip-pockets-for-storing-essential-items":"Twosidehippocketsforstoringessentialitems","sl-retail.product.description.two-sided-fleece-finish":"Two-sidedfleecefinish","sl-retail.product.description.two-sided-fleece-finish-which-provides-a-comfortable-touch":"Two-sidedfleecefinish,whichprovidesacomfortabletouch","sl-retail.product.description.two.front.twill.panels.with.foam.backing":"Twofronttwillpanelswithfoambacking","sl-retail.product.description.ultra-soft-polyester-hypo-alergenic-cotton-filling":"Ultra-softpolyesterfabricwithahypo-allergeniccottonfilling","sl-retail.product.description.una-mascara-que-da-mucho-miedo":"Unamascaraquedamuchomiedo","sl-retail.product.description.unfolded-notebook-size-11-6-x-8-5-inches":"Unfoldednotebooksize:11.6x8.5inches","sl-retail.product.description.unfolded-notebook-size-15-4-x-10-6-inches":"Unfoldednotebooksize:15.4x10.6inches","sl-retail.product.description.unfolded-notebook-size-29-5cm-x-21-5cm":"Unfoldednotebooksize:29.5cmx21.5cm","sl-retail.product.description.unique-christmas-stocking-for-kids-and-adults":"UniqueChristmasstockingforkidsandadults","sl-retail.product.description.unisex":"Unisex","sl-retail.product.description.unisex-style-that-s-fashionable-for-both-men-and-women":"Unisexstylethat'sfashionableforbothmenandwomen","sl-retail.product.description.up-to-one-year-outdoor-use-depending-on-environmental-conditions":"Uptooneyearoutdoorusedependingonenvironmentalconditions","sl-retail.product.description.update-your-home-decor-or-create-an-entire-colle-of-beautiful-wall-art-with-our-36x10-5-wooden-print-each-print-is-handmade-so-you-can-expect-the-product-to-he-its-own-unique-character-and-charm-no-two-pieces-will-look-the-same-making-them-thoughtful-gifts-for-all-occasions":"Updateyourhomedecororcreateanentirecolleofbeautifulwallartwithour36x10.5”WoodenPrint!Eachprintishandmade,soyoucanexpecttheproducttoheitsownuniquecharacterandcharm.Notwopieceswilllookthesame,makingthemthoughtfulgiftsforalloccasions.","sl-retail.product.description.upgrade-your-accessories-game-with-our-high-quality-men-s-leather-wallet-store-your-credit-cards-cash-and-must-hes-securely-and-stylishly-in-this-easy-to-carry-wallet":"Upgradeyouraccessoriesgamewithourhigh-qualityMen'sLeatherWallet.Storeyourcreditcards,cash,andmust-hessecurelyandstylishlyinthiseasy-to-carrywallet.","sl-retail.product.description.us-shoe-size":"USshoesize","sl-retail.product.description.usb-charging-cable-and-instructions-included":"USBchargingcableandinstructionsincluded","sl-retail.product.description.uses-advanced-3d-digital-printing-technology-for-a-vivid-ime-with-bright-color":"Usesadvanced3Ddigitalprintingtechnologyforavividimewithbrightcolor","sl-retail.product.description.uv-moisture-and-mildew-resistant-fabric":"UV,moistureandmildewresistantfabric","sl-retail.product.description.vacuum-insulation-keeps-your-hot-beveres-warm-and-your-cold-beveres-cool-for-a-longer-time":"Vacuuminsulationkeepsyourhotbevereswarmandyourcoldbeverescoolforalongertime","sl-retail.product.description.various-styles":"VariousStyles","sl-retail.product.description.velour-on-contrasting-side-for-soft-finish-white":"Velouroncontrastingsideforsoftfinishwhite","sl-retail.product.description.versatile-glass-for-beer-soft-drinks-water-and-cocktail-mixing":"Versatileglassforbeer,softdrinks,waterandcocktailmixing","sl-retail.product.description.very-blue":"Veryblue","sl-retail.product.description.very-cool":"Verycool","sl-retail.product.description.very-fancy":"Veryfancy","sl-retail.product.description.very-nice":"Verynice","sl-retail.product.description.very-soft":"Verysoft","sl-retail.product.description.very-white":"Verywhite","sl-retail.product.description.vibrant-sublimation-print":"Vibrantsublimationprint","sl-retail.product.description.wall-decor-pallet-look-and-design-adds-charm-and-uniqueness-to-this-home-d-cor-piece":"WALLDECOR:Palletlookanddesignaddscharmanduniquenesstothishomedécorpiece","sl-retail.product.description.warmer-weather-is-fast-approaching-so-get-your-hands-on-our-women-s-racerback-tanktop-asap-whether-you-sport-it-for-a-yoga-session-or-to-oid-the-summer-heat-our-tank-tops-for-women-are-versatile-and-perfect-year-round-these-racerback-tanks-are-perfect-for-layering-or-to-keep-you-cool-while-showcasing-your-fashionable-style":"Warmerweatherisfastapproaching,sogetyourhandsonourWomen’sRacerbackTanktopASAP!Whetheryousportitforayogasessionortooidthesummerheat,ourtanktopsforwomenareversatileandperfectyear-round.Theseracerbacktanksareperfectforlayeringortokeepyoucoolwhileshowcasingyourfashionablestyle.","sl-retail.product.description.warning-these-car-seat-covers-should-not-be-used-on-a-seat-with-side-airbs":"WARNING:ThesecarseatcoversshouldNOTbeusedonaseatwithsideairbs.","sl-retail.product.description.water-and-uv-resistant":"WaterandUVResistant","sl-retail.product.description.water.resistant.top.dark.brown.backing":"Waterresistanttop,darkbrownbacking","sl-retail.product.description.waterproof-anti-slip-washable-and-non-toxic":"Waterproof,anti-slip,washable,andnon-toxic","sl-retail.product.description.waterproof-durable-washable-and-non-toxic":"Waterproof,durable,washable,andnon-toxic","sl-retail.product.description.weight-15-17-oz":"Weight:15.17oz","sl-retail.product.description.weight-2-22-oz":"Weight:2.22oz","sl-retail.product.description.weight-5-50-oz":"Weight:5.50oz.","sl-retail.product.description.when-you-re-on-vacation-the-last-thing-you-should-worry-about-is-keeping-your-lugge-in-tip-top-shape-with-the-help-of-our-lugge-covers-you-can-rest-easy-knowing-your-piece-is-protected-from-dirt-scratches-and-more":"Whenyou'reonvacation,thelastthingyoushouldworryaboutiskeepingyourluggeintip-topshape.WiththehelpofourLuggeCovers,youcanresteasyknowingyourpieceisprotectedfromdirt,scratches,andmore.","sl-retail.product.description.whether-it-s-for-your-next-glamorous-night-out-or-a-casual-stroll-around-town-our-stylish-vertical-women-s-clutch-purse-suits-every-fashionista-s-preference":"Whetherit'sforyournextglamorousnightoutoracasualstrollaroundtown,ourstylish,verticalWomen'sClutchPursesuitseveryfashionista'spreference.","sl-retail.product.description.whether-you-re-weing-a-photo-or-graphic-design-these-cozy-blankets-will-turn-your-imes-into-heirloom-quality-pieces-great-to-display-on-the-wall-or-keep-you-warm-on-the-couch-woven-out-of-100-cotton-these-throws-feature-a-colorful-fringe-of-the-threads-your-ime-is-created-from-give-a-gift-they-can-cuddle-up-with-when-you-personalize-one-of-our-cozy-fleece-blankets-the-perfect-size-for-snuggling-on-the-couch-or-to-keep-warm-at-outdoor-events-these-fleece-blankets-feature-hemmed-edges-fleece-blankets-are-printed-on-one-side":"Whetheryou'reweingaphotoorgraphicdesign,thesecozyblanketswillturnyourimesintoheirloomqualitypiecesgreattodisplayonthewallorkeepyouwarmonthecouch.Wovenoutof100%cotton,thesethrowsfeatureacolorfulfringeofthethreadsyourimeiscreatedfrom.Giveagifttheycancuddleupwithwhenyoupersonalizeoneofourcozyfleeceblankets!Theperfectsizeforsnugglingonthecouchortokeepwarmatoutdoorevents,thesefleeceblanketsfeaturehemmededges.Fleeceblanketsareprintedononeside.","sl-retail.product.description.white":"white","sl-retail.product.description.white.nickel.bottom.grommets":"Whitenickelbottomgrommets","sl-retail.product.description.width-0-8-inches":"Width:0.8inches.","sl-retail.product.description.wipe-down-with-cold-damp-cloth-to-clean-do-not-use-harsh-chemicals":"Wipedownwithcolddampclothtoclean(donotuseharshchemicals)","sl-retail.product.description.womens-sizing":"Women’sSizing","sl-retail.product.description.wooden-hanging-rails-ailable-in-black-finish":"Woodenhangingrailsailableinblackfinish","sl-retail.product.description.works-with-laser-and-infrared-mice":"Workswithlaserandinfraredmice","sl-retail.product.description.wristband-or-face-covering":"orfacecovering","sl-retail.product.description.your-lugge-goes-in-and-out-up-and-down-and-all-around-protect-it-with-our-lugge-covers-that-are-made-to-last-no-matter-where-life-takes-you":"Yourluggegoesinandout,upanddown,andallaround.ProtectitwithourLuggeCoversthataremadetolastnomatterwherelifetakesyou.","sl-retail.product.description.zinc-alloy-stylishly-hung-from-a-cord-necklace":"Zincalloystylishlyhungfromacordnecklace","sl-retail.product.description.zinc-alloy-stylishly-hung-from-alloy-chain":"Zincalloystylishlyhungfromalloychain","sl-retail.receipt.add-on-order-succesful":"Add-OnOrderSuccessful!","sl-retail.receipt.customer-information":"CustomerInformation","sl-retail.receipt.order-number":"Order:","sl-retail.receipt.order-succesful":"OrderSuccessful!","sl-retail.receipt.order-summary":"OrderSummary","sl-retail.receipt.payment-method":"Paymentmethod","sl-retail.receipt.shipping-address":"ShippingAddress","sl-retail.receipt.thank-you-for-placing-your-order":"Thankyouforplacingyourorder","sl-retail.receipt.thank-you-for-your-order":"ThankYouForYourOrder!","sl-retail.receipt.you-will-receive-an-email-confirmation-shortly":"Youwillreceiveanemailconfirmationshortly.Ifyoudonotseeyourconfirmationemail,pleasecheckyourspamfolder","sl-retail.receipt.you-will-receive-and-email-confirmation-shortly":"Youwillreceiveanemailconfirmationshortly.Ifyoudonotseeyourconfirmationemail,pleasecheckyourspamfolder","sl-retail.receipt.your-order-is-estimated-to-arrive-between":"Yourorderisestimatedtoarrivebetween{start}-{end}","sl-retail.receipt.your-order-is-estimated-to-ship-between":"Yourorderwillshipbetween{earliest}and{latest}.Uponshipment,youwillreceiveanemailwithyourtrackingnumber.","sl-retail.receipt.your-order-will-ship-within-5-to-10-business-days":"Yourorderwillshipwithin5to10businessdaysofyourpaymentprocessing.Uponshipment,youwillreceiveanemailwithyourtrackingnumber.PleasebeawarethatorderprocessingandshipmentmaybedelayedduetotheglobalCOVID-19situation","sl-retail.receipt.your-order-will-ship-within-earliest-to-latest-business-days-covid":"Yourorderwillshipasearlyas{earliest}.Uponshipment,youwillreceiveanemailwithyourtrackingnumber.","sl-retail.remove-item-and-discounts":"RemoveItemandDiscounts","sl-retail.reward-promotion-banner.email":"continuewithemail","sl-retail.reward-promotion-banner.facebook":"ContinuewithFacebook","sl-retail.reward-promotion-banner.signup-email":"signupwithemail","sl-retail.reward-promotion-banner.signup-facebook":"SignUpwithFacebook","sl-retail.reward-promotion-confirmation.congrats":"Congratulations!","sl-retail.reward-promotion-confirmation.shop":"Shopnow","sl-retail.reward-promotion-confirmation.welcome":"WelcomeBack!","sl-retail.se-changes":"SeChanges","sl-retail.secondary-n.fathers-day":"ClickheretofindtheperfectFather'sDaygift!","sl-retail.shipping-get-expedited-shipping":"Getexpeditedshippingfor$2.99","sl-retail.shipping-guarenteed-to-arrive-by":"Guaranteedtoarriveby{date}","sl-retail.shipping-upgrade-to-3-day":"Upgradeto3-daydeliveryfor{price}","sl-retail.shipping.orders-ship-within-regions":"{regions}orderswillshipbetween{earliest}and{latest}.","sl-retail.size-charts.standard-shoe-size":"*Standardshoesize","sl-retail.slx.added-to-cart":"AddedtoCart","sl-retail.slx.added-to-cart-sc":"Addedtocart","sl-retail.slx.cart":"Cart","sl-retail.slx.cart-subtotal":"Cartsubtotal","sl-retail.slx.confirm-and-checkout":"ConfirmandCheckout","sl-retail.slx.confirm-quantity":"Isthisquantitycorrect?","sl-retail.slx.confirm-removal":"Areyousureyouwanttoremovethisitem?","sl-retail.slx.confirm-removal-description":"Youareabouttodeleteanitemfromyourcart.Areyousureyouwanttocontinue?","sl-retail.slx.continue-shopping":"ContinueShopping","sl-retail.slx.donate-now":"Iwouldliketodonate{amount}now!","sl-retail.slx.item":"item","sl-retail.slx.itemString":"{itemString}","sl-retail.slx.items":"items","sl-retail.slx.keep-it":"KeepIt","sl-retail.slx.keep-x-and-checkout":"Keep{quantity}andCheckout","sl-retail.slx.no-keep-it":"No,KeepIt","sl-retail.slx.paypal-direct-checkout-failed":"PayPaldirectcheckoutfailed.Pleasecontinuebelow.","sl-retail.slx.proceed-to-cart":"Proceedtocart","sl-retail.slx.remove-it":"RemoveIt","sl-retail.slx.view-item-in-cart":"ViewIteminCart","sl-retail.slx.who-donate-now":"CheckheretoroundupyourpurchaseforaW.H.Odonation","sl-retail.slx.yes-remove-it":"Yes,RemoveIt","sl-retail.slx.you-may-also-like":"YouMayAlsoLike","sl-retail.tcc-info-accordion.how-i-earn-cash.content-cashback":"Whenyoupurchaseeligibleitems,youwillreceivecashback\nthatcanberedeemedonTeeChip.com.Today,youcanearn{percente}%\ncashbackforeverydollaryouspend(notincludingtaxorshipping).\nNewoffersandpromotionsarecomingsoon!","sl-retail.tcc-info-accordion.what-is-tcc.note":"Somerestrictionmayapply","sl-retail.terms":"TermsofUse","sl-retail.terms-and-conditions":"Terms&Conditions","sl-retail.track-your-order":"Trackyourorder","sl-retail.upsell.add-to-order":"AddtoOrder","sl-retail.upsell.add-to-order-description":"addsthisadditionalitemandchargesyourpaymentmethod.","sl-retail.upsell.adding-to-order":"AddingToOrder...","sl-retail.upsell.amount-off":"Off","sl-retail.upsell.bundle":"CompleteYourBundleNow","sl-retail.upsell.complete-your-bundle":"CompleteYourBundle","sl-retail.upsell.ends-in-minutes":"Endsin","sl-retail.upsell.limited-time-offer":"LimitedTimeOffer","sl-retail.upsell.now-price":"Now{price}","sl-retail.upsell.one-click-description":"One-clickaddsitemandchargesyourpaymentmethod","sl-retail.upsell.shipping":"Willshipseparatelybetween{earliest}and{latest}","sl-retail.upsell.thank-you-limited-time-offer":"Thanksforyourorder!Foralimitedtime,youcanaddthisadditionalproducttoyourorderatadiscountedprice.","sl-retail.view-full-product-details":"Viewfullproductdetails","sl-retail.xmas-delivery-hint-2019":"Whenismyorderscheduledtoarrive?","sl-retail.xmas-delivery-hint-2019-eligible":"GuaranteedChristmasDelivery","sl-retail.xmas-delivery-hint-2019-ineligible":"Whenismyorderscheduledtoarrive?","sleeve-blanket":"SleeveBlanket","sleeve-blankets":"SleeveBlankets","sleeveless-tee":"SleevelessTee","sleevelesstee":"SleevelessTee","sling-pack":"SlingPack","slingpack":"SlingPack","slovakia":"Slovakia","slovenia":"Slovenia","slretailproductgroupedaccessorypouch":"AccessoryPouch","slretailproductgroupedbathmat":"BathMat","slretailproductgroupedcomforter":"Comforter","slretailproductgroupedcoralfleeceblanket":"FleeceBlanket","slretailproductgroupedduvetcover":"DuvetCover","slretailproductgroupedindoorpillow":"IndoorPillow","slretailproductgroupedpetbed":"PetBed","slretailproductgroupedpillowsham":"\nPillowSham","slretailproductgroupedposterlandscape":"HorizontalPoster","slretailproductgroupedposterstandard":"VerticalPoster","slretailproductgroupedquilt":"sl-retail.product-grouped.quilt","slretailproductgroupedsherpafleeceblanket":"SherpaFleeceBlanket","slretailproductgroupedtablerunner":"TableRunner","slretailproductgroupedwalltapestry":"WallTapestry","slretailproductgroupedwindowcurtain":"WindowCurtain","slretailproductgroupedwovenrugs":"WovenRug","slx.confirm-order-updates":"WehesentyouaconfirmationcodeviaSMSmobiletextmesse.Enteritbelowtoenableorderupdates.","slx.enter-confirmation-code":"ConfirmationCode","slx.enter-phone-order-updates":"EnterPhoneNumberforOrderUpdates","slx.retry-confirmation-code":"Didn’treceivetheconfirmationcode?Giveitaminuteand","small-fleece-blanket-30-x-40-":"SmallFleeceBlanket-30\"x40\"","smallfleeceblanket30x40":"SmallFleeceBlanket-30\"x40\"","sml":"Small","socks":"Socks","soft-long-cat-pillow-stuffed-plush-toys":"SoftLongCatPillowStuffedPlushToys","soft-pink":"SoftPink","softpink":"SoftPink","solo-nylon-braid-strap-for-apple-watch":"SoloNylonBraidStrapforAppleWatch","solomon-islands":"SolomonIslands","somalia":"Somalia","some.id":"ContactUs","sort":"Sort","sort-by":"Sortby","south-africa":"SouthAfrica","south-georgia-and-the-south-sandwich-islands":"SouthGeorgiaandtheSouthSandwichIslands","south-korea":"SouthKorea","south-sudan":"SouthSudan","spain":"Spain","sport-grey":"SportGrey","sports-grey":"SportsGrey","sportsgrey":"SportsGrey","spubonva-cors-burlesco-y-falda-conjunto-de-cors-de-encaje-vestidos-g-ticos-y-corpi-o-fiesta-sexy-vinte-color-negro-de-talla-grande":"Spubonva-corséburlescoyfalda,conjuntodecorsédeencaje,vestidosgóticosycorpiño,fiesta,sexy,vinte,colornegro,detallagrande","square-coaster":"SquareCoaster","square-mnet":"SquareMnet","square-mnets":"Squaremnets","square-pillowcase":"SquarePillowcase","squarecoaster":"SquareCoaster","squaremnet":"SquareMnet","squarepillowcase":"SquarePillowcase","sri-lanka":"SriLanka","st--christopher":"St.Christopher","st--eustatius":"St.Eustatius","st--georgia":"St.Georgia","st--helena":"St.Helena","st--kitts-&-nevis":"St.Kitts&Nevis","st--vincent":"St.Vincent","stainless-steel-manual-juicer":"StainlessSteelManualJuicer","star-ornament-3-pieces-porcelain-":"Starornament-3pieces(porcelain)","star-ornament-3-pieces-wood-":"Starornament-3pieces(wood)","star-ornament-porcelain-":"StarOrnament(Porcelain)","star-ornament-single-porcelain-":"Starornament-single(porcelain)","star-ornament-single-wood-":"Starornament-single(wood)","star-ornament-wood-":"StarOrnament(Wood)","start-date":"Startdate","sticker-10-pack-horizontal-":"Sticker-10pack(Horizontal)","sticker-10-pack-vertical-":"Sticker-10pack(Vertical)","sticker-2-pack-horizontal-":"Sticker-2pack(Horizontal)","sticker-2-pack-vertical-":"Sticker-2pack(Vertical)","sticker-4-pack-horizontal-":"Sticker-4pack(Horizontal)","sticker-4-pack-vertical-":"Sticker-4pack(Vertical)","sticker-6-pack-horizontal-":"Sticker-6pack(Horizontal)","sticker-6-pack-vertical-":"Sticker-6pack(Vertical)","sticker-8-pack-horizontal-":"Sticker-8pack(Horizontal)","sticker-8-pack-vertical-":"Sticker-8pack(Vertical)","sticker-single-horizontal-":"Sticker-single(horizontal)","sticker-single-vertical-":"Sticker-Single(Vertical)","stickers":"Stickers","stitch-27cm-cartoon-animal":"Stitch27cmCartoonAnimal","street-style-sexy-mid-rise-distressed-trouser-stretch-skinny-hole-denim-pencil-pants-blue-ripped-jeans-women-split":"StreetStyleSexyMidRiseDistressedTrouserStretchSkinnyHoleDenimPencilPantsBlueRippedJeansWomenSplit","stretched-length-16inches-density-150-density-13x4-wig":"StretchedLength:16inches/Density:150Density13x4Wig","stretched-length-8inches-density-150-density-13x4-wig":"StretchedLength:8inches/Density:150Density13x4Wig","stretched-length-8inches-density-full-lace-wig":"StretchedLength:8inches/Density:FullLaceWig","stripecarderror.card_declined":"Thecardwasdeclined.","stripecarderror.expired_card":"Thecardhasexpired.","stripecarderror.incorrect_cvc":"Thecard'ssecuritycodeisincorrect.","stripecarderror.incorrect_number":"Thecardnumberisincorrect.","stripecarderror.incorrect_zip":"Thecard'szipcodefailedvalidation.","stripecarderror.invalid_cvc":"Thecard'ssecuritycodeisinvalid.","stripecarderror.invalid_expiry_month":"Thecard'sexpirationmonthisinvalid.","stripecarderror.invalid_expiry_year":"Thecard'sexpirationyearisinvalid.","stripecarderror.invalid_number":"Thecardnumberisnotavalidcreditcardnumber.","stripecarderror.invalid_swipe_data":"Thecard'sswipedataisinvalid.","stripecarderror.missing":"Anerroroccurredwhileprocessingthecard.","stripecarderror.processing_error":"Anerroroccurredwhileprocessingthecard.","style":"Style","submit":"Submit","sudan":"Sudan","summer-men-and-women-couples-zelda-3dt-shirt-pattern-breathable-polyester-material-oversized-t-shirt-clothes-size":"summermenandwomencoupleszelda3DTshirtpatternbreathablepolyestermaterialoversizedT-shirtclothessize","summer-women-solid-color-open-toe-casual-ladies-wedge-shoes-hollow-out-slip-on-mesh-platform-female-sandalias-2021-mujer":"SummerWomenSolidColorOpenToeCasualLadiesWedgeShoesHollowOutSlip-OnMeshPlatformFemaleSandalias2021Mujer","sunshine":"Sunshine","suriname":"Suriname","svalbard-and-jan-mayen":"SvalbardandJanMayen","swaziland":"Swaziland","sweatpants":"Sweatpants","sweatshirt":"Sweatshirt","sweatshirts":"Sweatshirts","sweden":"Sweden","switzerland":"Switzerland","syrian-arab-republic":"SyrianArabRepublic","t-shirt":"T-Shirt","t-shirts":"T-Shirts","table-placemat":"TablePlacemat","table-runner-72-x-16-":"TableRunner-72\"x16\"","table-runner-90-x-16-":"TableRunner-90\"x16\"","tableplacemat":"TablePlacemat","tablerunner72x16":"TableRunner-72\"x16\"","tablerunner90x16":"TableRunner-90\"x16\"","tactical-gun-holster":"TacticalGunHolster","taiwan":"Taiwan","tajikistan":"Tajikistan","tank-top":"Tank-top","tank-tops":"TankTops","tanktops":"TankTops","tanzania":"Tanzania","tarot-tapestry-wall-hanging":"TarotTapestryWallHanging","tea-towel":"TeaTowel","tea-towels":"TeaTowels","teal":"Teal","team-purple":"TeamPurple","teampurple":"TeamPurple","teardrop-earrings":"TeardropEarrings","teardropearrings":"TeardropEarrings","teatowel":"TeaTowel","teatowels":"TeaTowels","terms-and-privacy":"Terms&Privacy","terms-of-use":"Termsofuse","thailand":"Thailand","thank":"Thankyouforyourrecentpurchase,wehopeyouloveit!Pleaseshareyourreview:","thank-your-for-your-recent-purchase-please-share-your-review":"Thankyouforyourrecentpurchase.Wehopeyouloveit!Letusknowwhatyouthink:","thank-your-for-your-recent-purchase-please-share-your-review-masks":"Thankyouforyourrecentmaskpurchase,wehopeyouloveit!Pleaseincludeaphotoandacommentinyourreviewtoqualifyforthechancetowinour$1000prize.","threshold-progress-bar.away-from":"awayfromFREEshipping","threshold-progress-bar.title":"You'veearnedFREEshipping!","tie":"Tie","ties":"Ties","timor-leste":"Timor-Leste","today-only":"TodayOnly","togo":"Togo","tokelau":"Tokelau","tonga":"Tonga","tote-b":"Toteb","tote-bs":"ToteBs","toteb":"ToteB","totebs":"ToteBs","totets=":"totets=","towels":"Towels","track-order":"Trackorder","training-length-socks":"TrainingLengthSocks","traininglengthsocks":"TrainingLengthSocks","transparent-1318-gamepads-clear-back-b-protective-cover-case-for-switch-ns-nx-cases-cover-for-switch-ultra-thin-pc":"Transparent1318GamepadsClearBackBProtectiveCoverCaseForSwitchNSNXCasesCoverForSwitchUltraThinPC","transparent-gamepads-clear-back-b-protective":"TransparentGamepadsClearBackBProtective","trinidad":"Trinidad","trinidad-and-tobo":"TrinidadandTobo","tristan-da-cunha":"TristandaCunha","trucker-hat":"TruckerHat","truckerhat":"TruckerHat","true-red":"TrueRed","true-royal":"TrueRoyal","truered":"TrueRed","tshirts":"T-Shirts","tumblers":"Tumblers","tunisia":"Tunisia","turkey":"Turkey","turkmenistan":"Turkmenistan","turks-and-caicos-islands":"TurksandCaicosIslands","turquoise":"Turquoise","tuvalu":"Tuvalu","twin":"Twin","twin-quilt-bed-set":"TwinQuiltBedSet","uganda":"Uganda","ukraine":"Ukraine","unas-pilillas":"unaspilillas","undefined":"AreYouSure?","underwear":"Underwear","unisex-sweatpants":"UnisexSweatpants","unisex-tank":"UnisexTank","unisex-tank-":"Unisextank","unisex-tanks":"UnisexTanks","unisextank":"UnisexTank","united-arab-emirates":"UnitedArabEmirates","united-kingdom":"UnitedKingdom","united-states":"UnitedStates","united-states-minor-outlying-islands":"UnitedStatesMinorOutlyingIslands","unknown-error-communicating-with-server":"Unknownerrorcommunicatingwithserver","update":"Update","upload-photos-order":"Uploadphoto(s)ofyourorder","upload-photos-order-masks":"Uploadphoto(s)ofyourmask","uruguay":"Uruguay","useful-links.contact-us":"ContactUs","useful-links.faq":"FAQ","useful-links.file-a-claim":"Fileaclaim","useful-links.links":"Usefullinks","useful-links.payments":"Payments","useful-links.return":"Returns&Exchanges","useful-links.returns":"ReturnsandExchanges","useful-links.size-chart":"Sizechart","useful-links.track-order":"Trackmyorder","uzbekistan":"Uzbekistan","v-neck-shirt":"V-neckshirt","v-neck-shirts":"V-NeckShirts","v-neck-t-shirt":"V-NeckT-Shirt","v-neck-tee":"V-NeckT-Shirt","vacuum-bottle":"VacuumBottle","vanuatu":"Vanuatu","venezuela":"Venezuela","vertical-poster":"VerticalPoster","vietnam":"Vietnam","vinte-turtleneck":"VinteTurtleneck","violet":"Violet","vip-cat-toy":"VIPCATTOY","virgin-islands,-british":"VirginIslands,British","virgin-islands,-u-s-":"VirginIslands,u.s.","vnecktee":"V-NeckTee","vnecktshirt":"V-NeckT-Shirt","wall-clock":"WallClock","wall-decoration":"WallDecoration","wall-tapestries":"WallTapestries","wall-tapestry-104-x-88-":"WallTapestry-104\"x88\"","wall-tapestry-36-x-26-":"WallTapestry-36\"x26\"","wall-tapestry-60-x-51-":"WallTapestry-60\"x51\"","wall-tapestry-80-x-68-":"WallTapestry-80\"x68\"","walldecoration":"WallDecoration","wallis-and-futuna":"WallisandFutuna","walltapestries":"WallTapestries","walltapestry104x88":"WallTapestry-104\"x88\"","walltapestry26x36":"WallTapestry26x36","walltapestry36x26":"WallTapestry-36\"x26\"","walltapestry51x60":"WallTapestry51x60","walltapestry60x51":"WallTapestry-60\"x51\"","walltapestry68x80":"WallTapestry68x80","walltapestry80x68":"WallTapestry-80\"x68\"","walltapestry88x104":"WallTapestry88x104","warm-thermal-gloves-cycling-running-driving-gloves":"WarmThermalGlovesCyclingRunningDrivingGloves","water-tap-booster-shower-kitchen-water-filter-tap-head-360-adjustable-rotating-faucet-nozzle-home-kitchen-accessories":"WaterTapBoosterShowerKitchenWaterFilterTapHead360AdjustableRotatingFaucetNozzleHomeKitchenAccessories","waterproof-pet-cat-litter-mat":"WaterproofPetCatLitterMat","we-sent-you-a-confirmation-email":"Wesentyouaconfirmationemail.Pleasecheckyouremailandclickthelinkinsidetoactivateyouraccount.","weekender-tote":"WeekenderTote","weekendertote":"WeekenderTote","western-sahara":"WesternSahara","white":"White","window-cortains":"WindowCortains","window-curtain-blackout":"WindowCurtain-Blackout","window-curtain-sheer":"WindowCurtain-Sheer","window-curtains":"WindowCurtains","windowcurtainblackout":"WindowCurtain-Blackout","windowcurtains":"WindowCurtains","windowcurtainsheer":"WindowCurtain-Sheer","wine":"Wine","wine-tumbler":"WineTumbler","wireless-blackhead-remover-with-camera":"WirelessBlackheadRemoverwithCamera","women":"Women","women-s":"Women's","women-s-all-over-print-full-zip-hoodie":"Women'sAllOverPrintFullZipHoodie","women-s-all-over-print-hoodie":"Women'sAllOverPrintHoodie","women-s-all-over-printed-tank":"Women'sAll-Over-PrintedTank","women-s-all-over-printed-tee":"Women'sAll-Over-PrintedTee","women-s-aop-t-shirt-l":"Women'sAOPT-ShirtL","women-s-aop-t-shirt-m":"Women'sAOPT-ShirtM","women-s-aop-t-shirt-s":"Women'sAOPT-ShirtS","women-s-briefs":"Women'sBriefs","women-s-classic-polo-tee":"Women'sClassicPoloTee","women-s-classic-tee":"Women'sClassicTee","women-s-dress-shirt":"Women'sDressShirt","women-s-flip-flops":"Women'sFlipFlops","women-s-flowy-tank":"Women'sFlowyTank","women-s-high-top-shoes":"Women'sHighTopShoes","women-s-high-top-white-shoes":"Women'sHighTopWhiteShoes","women-s-hoodies":"Women'sHoodies","women-s-lace-panties":"Women'sLacePanties","women-s-lightweight-jacket":"Women'sLightweightJacket","women-s-long-sleeve":"Women'sLongSleeve","women-s-low-top-shoes":"Women'sLowTopShoes","women-s-low-top-white-shoes":"Women'sLowTopWhiteShoes","women-s-premium-tee":"Women'sPremiumTee","women-s-racerback-tank-dress-l":"Women'sRacerbackTankDressL","women-s-racerback-tank-dress-m":"Women'sRacerbackTankDressM","women-s-racerback-tank-dress-s":"Women'sRacerbackTankDressS","women-s-racerback-tanktop-l":"Women'sRacerbackTanktopL","women-s-racerback-tanktop-m":"Women'sRacerbackTanktopM","women-s-racerback-tanktop-s":"Women'sRacerbackTanktopS","women-s-shoes":"Women'sShoes","women-s-t-shirts":"Women'sT-Shirts","women-s-tank-tops":"Women'sTankTops","women-socks":"women.socks","women-t-shirtssss":"women.t-shirtssss","women.all-over-print-dresses":"women.all-over-print-dresses","women.all-over-print-dresses.women-racerback-tank-dress-l":"women.all-over-print-dresses.women-racerback-tank-dress-l","women.all-over-print-dresses.women-racerback-tank-dress-m":"women.all-over-print-dresses.women-racerback-tank-dress-m","women.all-over-print-dresses.women-racerback-tank-dress-s":"women.all-over-print-dresses.women-racerback-tank-dress-s","women.dresses":"WomenDresses","women.dresses.dress":"WomenDresses","women.footwear":"women.footwear","women.footwear.shoes":"women.footwear.shoes","women.footwear.shoes.flip-flops":"women.footwear.shoes.flip-flops","women.footwear.shoes.women-high-top-shoes":"women.footwear.shoes.women-high-top-shoes","women.footwear.shoes.women-low-top-shoes":"women.footwear.shoes.women-low-top-shoes","women.footwear.socks":"women.footwear.socks","women.footwear.socks.sock":"women.footwear.socks.sock","women.hoodies":"women.hoodies","women.hoodies.hoddie":"WomenHoodies!","women.hoodies.hoodie":"WomenHoodies!","women.hoodies.women-hoodie":"women.hoodies.women-hoodie","women.leggings":"women.leggings","women.leggings.high-waist-leggings":"women.leggings.high-waist-leggings","women.leggings.legging":"women.leggings.legging","women.long-sleeve":"women.long-sleeve","women.long-sleeve.baseball-tee":"women.long-sleeve.baseball-tee","women.long-sleeve.crewneck-shirt":"women.long-sleeve.crewneck-shirt","women.long-sleeve.crewneck-shirt.longsleeve":"women.long-sleeve.crewneck-shirt.longsleeve","women.long-sleeve.dress-shirt":"women.long-sleeve.dress-shirt","women.long-sleeve.lightweight-jacket":"women.long-sleeve.lightweight-jacket","women.sweatpants":"women.sweatpants","women.sweatpants.sweatpant":"women.sweatpants.sweatpant","women.sweatshirts":"women.sweatshirts","women.sweatshirts.sweatshirt":"women.sweatshirts.sweatshirt","women.t-shirts":"women.t-shirts","women.t-shirts.all-over-print-shirts":"women.t-shirts.all-over-print-shirts","women.t-shirts.all-over-print-shirts.l":"women.t-shirts.all-over-print-shirts.l","women.t-shirts.all-over-print-shirts.m":"women.t-shirts.all-over-print-shirts.m","women.t-shirts.all-over-print-shirts.s":"women.t-shirts.all-over-print-shirts.s","women.t-shirts.all-over-printed-tee":"women.t-shirts.all-over-printed-tee","women.t-shirts.all-over-printed-tee.aos-shirt":"women.t-shirts.all-over-printed-tee.aos-shirt","women.t-shirts.classic-polo":"women.t-shirts.classic-polo","women.t-shirts.ladies-tee":"women.t-shirts.ladies-tee","women.t-shirts.ladies-tee.women-shirt":"women.t-shirts.ladies-tee.women-shirt","women.t-shirts.premium-fitted-tee":"women.t-shirts.premium-fitted-tee","women.t-shirts.premium-fitted-tee.women-premium-fitted":"women.t-shirts.premium-fitted-tee.women-premium-fitted","women.tank-tops":"women.tank-tops","women.tank-tops.all-over-print-tanktop":"women.tank-tops.all-over-print-tanktop","women.tank-tops.all-over-print-tanktop.l":"women.tank-tops.all-over-print-tanktop.l","women.tank-tops.all-over-print-tanktop.m":"women.tank-tops.all-over-print-tanktop.m","women.tank-tops.all-over-print-tanktop.s":"women.tank-tops.all-over-print-tanktop.s","women.tank-tops.all-over-printed-tank":"women.tank-tops.all-over-printed-tank","women.tank-tops.all-over-printed-tank.all-over-tanktop":"women.tank-tops.all-over-printed-tank.all-over-tanktop","women.tank-tops.flowy-tank":"women.tank-tops.flowy-tank","women.tank-tops.flowy-tank.women-tanktop":"women.tank-tops.flowy-tank.women-tanktop","women.tank-tops.unisex-tank":"women.tank-tops.unisex-tank","women.tank-tops.unisex-tank.tanktop":"women.tank-tops.unisex-tank.tanktop","women.underwear":"women.underwear","women.underwear.briefs":"women.underwear.briefs","women.underwear.lace-panties":"women.underwear.lace-panties","womens-all-over-printed-tank":"Women'sAll-Over-PrintedTank","womens-all-over-printed-tee":"Women'sAll-Over-PrintedTee","womens-classic-polo-tee":"Women'sClassicPoloTee","womens-classic-tee":"Women'sClassicTee","womens-dress-shirt":"Women'sDressShirt","womens-dresses":"Women'sDresses","womens-flowy-tank":"Women'sFlowyTank","womens-hoodies":"Women'sHoodies","womens-leggings":"Women'sLeggings","womens-lightweight-jacket":"Women'sLightweightJacket","womens-long-sleeve":"Women'sLongSleeve","womens-premium-tee":"Women'sPremiumTee","womens-sweatshirts":"Women'sSweatshirts","womens-t-shirts":"Women'sT-Shirts","womens-tank-tops":"Women'sTankTops","womens-unisex-tank":"Women'sUnisexTank","womensalloverprintedtank":"Women'sAll-Over-PrintedTank","womensalloverprintedtee":"Women'sAll-Over-PrintedTee","womensclassicpolotee":"Women'sClassicPoloTee","womensdresses":"Women'sDresses","womenslongsleeve":"Women'sLongSleeve","womensocks":"women.socks","womenssweatshirts":"Women'sSweatshirts","womenstanktops":"Women'sTankTops","womenstshirts":"Women'sT-Shirts","wooden-prints":"WoodenPrints","woven-rug-3-x-2-":"WovenRug-3'x2'","woven-rug-6-x-4-":"WovenRug-6'x4'","woven-rugs":"WovenRugs","wovenrug3feetx2feet":"WovenRug3feetx2feet","wovenrug3x2":"WovenRug-3'x2'","wovenrug6x4":"WovenRug-6'x4'","wovenrugs":"WovenRugs","write-your-review":"Leeareview","xlg":"X-Large","xsml":"X-Small","xxl":"2X-Large","xxxl":"3X-Large","xxxxl":"4X-Large","xxxxxl":"5X-Large","xxxxxxl":"6X-Large","yard-signs":"YardSigns","yellow":"Yellow","yemen":"Yemen","yoga-mat":"YogaMat","yoga-mat-24x70-vertical-":"YogaMat24x70(vertical)","yoga-mat-70x24-horizontal-":"YogaMat70x24(horizontal)","you-might-want-to-try":"YouMightWantToTry","you.se":"Youse","your-account-has-been-successfully-created":"Youhe{amount}tospendonyournextorder.","your-preferences-sed":"Yourpreferenceshebeensed","youth":"youth","youth-&-baby":"Youth&Baby","youth-baby":"Youth&Baby","youth-shirts":"Youthshirts","youth-t-shirt":"YouthT-Shirt","youth-t-shirts":"YouthT-Shirts","youthbaby":"Youth&Baby","youthhoodies-kids":"youthhoodieskids","youthtshirt":"YouthT-Shirt","youthtshirts":"YouthT-Shirts","zaire":"Zaire","zambia":"Zambia","zimbabwe":"Zimbabwe","åland-islands":"ÅlandIslands"},"currency":"USD","exchangeRate":1,"namespace":"sl-retail"},"loading":false,"modal":{},"notifications":{},"retailCart":{"groupId":"587d0d41cee36fd012c64a69","_id":"bcd5aa3002f4a45bd","remarketing":[{"type":"recommendation","source":"default","data":{"items":[{"msrp":14.89,"price":12.95,"link":"/wifisignal?retailProductCode=393BC8DA44B1A2-818F020C5AC7-GS1-TC0-BLK","ime":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/393BC8DA44B1A2/393BC8DA44B1A2-818F020C5AC7-GS1-TC0-BLK/front/designLineVersion/v1/medium.jpg","name":"Bestrongiwhispertomywifisignal","type":"product"},{"msrp":14.89,"price":12.95,"link":"/beautifulboatonriver?retailProductCode=393BC8DA44B1A2-E1BFBC6-GS1-TC0-WHT","ime":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/393BC8DA44B1A2/393BC8DA44B1A2-E1BFBC6-GS1-TC0-WHT/front/designLineVersion/v1/medium.jpg","name":"BeautifulBoatonRiver","type":"product"},{"msrp":18.38,"price":15.99,"link":"/vivaciousspirit?retailProductCode=643EABAB45F1B3-C384D371CF2A-GS0-TC0-BLK","ime":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/643EABAB45F1B3/643EABAB45F1B3-C384D371CF2A-GS0-TC0-BLK/front/designLineVersion/v1/medium.jpg","name":"VivaciousSpirit","type":"product"},{"msrp":24.09,"price":20.95,"link":"/design-weaslsn?retailProductCode=F4BFB4B7-1CD7040B59AA-GS0-TC0-WHT","ime":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/F4BFB4B7/F4BFB4B7-1CD7040B59AA-GS0-TC0-WHT/front/designLineVersion/v1/medium.jpg","name":"ILOVEADAMDRIVERSHIRT","type":"product"},{"msrp":14.89,"price":12.95,"link":"/eleflyingtothebookstore?retailProductCode=B44A0E3-188B49BC1F1A-GS0-TC0-WHT","ime":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/B44A0E3/B44A0E3-188B49BC1F1A-GS0-TC0-WHT/front/designLineVersion/v1/medium.jpg","name":"EleFlyingtotheBookstore","type":"product"},{"msrp":16.04,"price":13.95,"link":"/letsgetlost2?retailProductCode=393BC8DA44B1A2-3EDB96-GS1-TC0-WHT","ime":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/393BC8DA44B1A2/393BC8DA44B1A2-3EDB96-GS1-TC0-WHT/front/designLineVersion/v1/medium.jpg","name":"Let'sGetLost","type":"product"},{"msrp":16.04,"price":13.95,"link":"/lifesjourneyenjoytheride?retailProductCode=393BC8DA44B1A2-D4B87-GS0-TC0-WHT","ime":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/393BC8DA44B1A2/393BC8DA44B1A2-D4B87-GS0-TC0-WHT/front/designLineVersion/v1/medium.jpg","name":"Life'sJourneyEnjoyTheRide","type":"product"},{"msrp":16.04,"price":13.95,"link":"/intheforestifindmypeace?retailProductCode=393BC8DA44B1A2-BD4BD3-GS0-TC0-WHT","ime":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/393BC8DA44B1A2/393BC8DA44B1A2-BD4BD3-GS0-TC0-WHT/front/designLineVersion/v1/medium.jpg","name":"InTheForestIFindMyPeace","type":"product"},{"msrp":16.04,"price":13.95,"link":"/lifesgreatestjourneysbeginwithsinglestep?retailProductCode=393BC8DA44B1A2-FD1ED2-GS1-TC0-WHT","ime":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/393BC8DA44B1A2/393BC8DA44B1A2-FD1ED2-GS1-TC0-WHT/front/designLineVersion/v1/medium.jpg","name":"Life'sGreatestJourneysBeginWithSingleStep","type":"product"},{"msrp":24.14,"price":21,"link":"/amazing-glitter-tumbler-for-squirrel-lovers?retailProductCode=98D1A501EFA1E6-E7ADC9CF0F4B-S3GT20-YL1032-WHT","ime":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/98D1A501EFA1E6/98D1A501EFA1E6-E7ADC9CF0F4B-S3GT20-YL1032-WHT/front/designLineVersion/v1/medium.jpg","name":"Amazing20ozGlitterTumblerForSquirrelLoversGift.","type":"product"}]}}],"data":{"marketing":[]},"messes":[],"lastActivityAt":"2024-07-16T05:30:51.344Z","createdAt":"2024-07-16T05:30:51.344Z","bundles":[],"discounts":[],"fees":[],"items":[]},"retailAuth":{},"retailCheckout":{"step":"delivery","address":{"shipping":{},"billing":{}},"sameAddress":true,"card":{},"consentsAdvertising":true,"stripe":{}},"retailEntity":{},"retailGroup":{"_id":"587d0d41cee36fd012c64a69","pricingId":"58b3d0d06f49dc581f9a7828","name":"TeeChip","template":"teechip","createdAt":"2017-01-16T18:13:21.382Z","data":{"fbAppId":"7395","nortonSeal":true,"marketplace":true,"storefrontStyle":"default","trackingTs":{"googleAdwordsId":"","googleAnalyticsId":"UA-8-1","googleOptimizeId":"GTM-5X2C5RV","facebookPixelId":""},"socialMedia":{"facebook":"teechipofficial","twitter":"teechipofficial","instram":"teechip"},"ts":{"style":[]},"topStyles":[],"branding":"group","customNTs":[],"featuredStorefronts":[],"showFeaturedStorefronts":true,"webOfTrustCertificateUrl":"s3-us-west-2.amazonaws.com/scalable-licensing/public/assets/webOfTrustCertificates/teechip_mywot69b7cca4c661a6b50e27.html","showTrendingProducts":true,"couponBanners":[{"icon":"t","messe":"20%discountonallorders","couponId":"5cdb50afce","_id":"5cdb50afcf"}],"nigationTs":[],"tcVersion":3,"tcOptedIn":true,"featureSettings":[{"enabled":true,"name":"slx-upsell-between-buy-cart"},{"enabled":true,"name":"add-matching-items-v1"},{"enabled":false,"name":"slx-threshold-progress-bar"},{"enabled":false,"name":"slx-freq-bought"},{"enabled":true,"name":"slx-disable-countdown"},{"enabled":true,"name":"slx-disable-campaign-description"},{"enabled":true,"name":"slx-disable-mobile-last-day-order"},{"name":"slx-cart-pre-purchase-upsell-v1","enabled":false},{"name":"slx-embed-cart-pe-upsell","enabled":false},{"enabled":false,"name":"disable-slashed-price"},{"enabled":true,"name":"cta-btn-buy-it-now"},{"enabled":false,"name":"cta-btn-add-to-cart"}],"appleDomainVerificationUrl":"scalable-licensing.s3.amazonaws.com/public/assets/domain-verifications/teechip-com","applePayVerified":true,"sitemap":{"indexUrl":"scalable-licensing.s3.amazonaws.com/public/assets/sitemaps/teechip-com-sitemap.xml","urls":["scalable-licensing.s3.amazonaws.com/public/assets/sitemaps/teechip-com-sitemap-0.xml"]},"showHomepeCategories":true,"siteVerification":{"gmc":"google4d63ffee383"},"showRecommendedWidget":true,"hiddenRetailSections":[]},"colors":{"primary":{"hex":"FC6514","pms":"orange"}},"shipping":{"prices":[{"productId":"56ecbc96b90bb97f36a812e5","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"56ecbc97b90bb97f36a812e6","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"56ecbc97b90bb97f36a812e7","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"56ecbc97b90bb97f36a812e8","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"56ecbc97b90bb97f36a812e9","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"56ecbc97b90bb97f36a812ea","international":{"base":600,"additional":199},"domestic":{"base":400,"additional":199}},{"productId":"56ecbc97b90bb97f36a812eb","international":{"base":600,"additional":199},"domestic":{"base":400,"additional":199}},{"productId":"56ecbc98b90bb97f36a812ec","international":{"base":600,"additional":199},"domestic":{"base":400,"additional":199}},{"productId":"56ecbc98b90bb97f36a812ed","international":{"base":600,"additional":199},"domestic":{"base":400,"additional":199}},{"productId":"56ecbc98b90bb97f36a812ee","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"56ecbc98b90bb97f36a812ef","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"56ecbc98b90bb97f36a812f0","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"56ecbc98b90bb97f36a812f1","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"56ecbc98b90bb97f36a812f2","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"56ecbc98b90bb97f36a812f3","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"56ecbc98b90bb97f36a812f4","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"57a102bf9c71a4a4594bfc83","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d8ff43ea40edad","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d8ff43ea40edae","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d8ff43ea40edaf","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d8ff43ea40edb0","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d8ff43ea40edb1","international":{"base":600,"additional":199},"domestic":{"base":400,"additional":199}},{"productId":"587d0d8ff43ea40edb2","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d8ff43ea40edb3","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d8ff43ea40edb4","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d8ff43ea40edb5","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d8ff43ea40edb6","international":{"base":600,"additional":199},"domestic":{"base":400,"additional":199}},{"productId":"587d0d90f43ea40edb7","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d90f43ea40edb8","international":{"base":600,"additional":199},"domestic":{"base":400,"additional":199}},{"productId":"587d0d90f43ea40edb9","international":{"base":600,"additional":199},"domestic":{"base":400,"additional":199}},{"productId":"587d0d90f43ea40edba","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d90f43ea40edbb","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d90f43ea40edbc","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d90f43ea40edbd","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d90f43ea40edbe","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d90f43ea40edbf","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d90f43ea40edc0","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d90f43ea40edc1","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d90f43ea40edc2","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d90f43ea40edc3","international":{"base":300,"additional":399},"domestic":{"base":100,"additional":399}},{"productId":"587d0d90f43ea40edc4","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d90f43ea40edc5","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"587d0d90f43ea40edc6","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"58a152fc794","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"58b9458e9c17f1783b8603d2","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"58bb705c560da2b67","international":{"base":300,"additional":399},"domestic":{"base":100,"additional":399}},{"productId":"58d5c9b9bb1c2a506ae7a940","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"58dfb47d8b2cadbbc7","international":{"base":400,"additional":199},"domestic":{"base":200,"additional":199}},{"productId":"58f1aaac7770dd","international":{"base":599,"additional":199},"domestic":{"base":399,"additional":199}},{"productId":"58f1aaac7770db","international":{"base":599,"additional":199},"domestic":{"base":399,"additional":199}}],"fees":{"rush":300}},"logo":"cdn.32pt.com/cdn-cgi/ime/width=300,height=300,fit=contain,quality=90/dbcpu9gznkryx.cloudfront.net/public/assets/teechip_logo.png","review":{"text":{"status":"approved"}},"status":"active","banner":"oo-prod.s3.amazonaws.com/public/artworks/2018/02/25/f40e5eab38a0f69/original.jpg","shippingId":"5ab542b9bec3c6ef80f7ec5a","landingPe":{"banners":[{"ime":"cdn.32pt.com/uploads/banners/2022/04/18/d8554ea776cdcd45.png","link":"/shop/men?ase_source=marketing&ase_reference=marketing&utm_medium=website&utm_source=sfsl_homepe&utm_campaign=creators%20apparel"},{"ime":"cdn.32pt.com/uploads/banners/2022/02/10/422af7ddedc.png","link":"/stores/plant-lover-gifts?ase_source=marketing&ase_reference=marketing&utm_medium=website&utm_source=sfsl_homepe&utm_campaign=plant%20lover%20gifts"},{"ime":"cdn.32pt.com/uploads/banners/2021/10/12/e66ed2fe5facab89.png","link":"/shop/home-living/filtered/-/-?ase_source=marketing&ase_reference=marketing&utm_medium=website&utm_source=sfsl_homepe&utm_campaign=creators%20home%20and%20living"}],"featuredCategories":[{"text":"Shirts","ime":"scalable-licensing.s3-us-west-2.amazonaws.com/public/imes/category-cards/t-shirts-shop.png","url":"/shop/men/t-shirts","color":"rouge","offset":"p5"},{"text":"FaceMasks","ime":"scalable-licensing.s3-us-west-2.amazonaws.com/public/imes/category-cards/printed-face-masks.png","url":"/shop/accessories/masks","color":"blue","offset":"1"},{"text":"Stickers","ime":"scalable-licensing.s3-us-west-2.amazonaws.com/public/imes/category-cards/stickers.png","url":"/shop/accessories/stickers","color":"yellow","offset":"1"},{"text":"HomeDecor","ime":"scalable-licensing.s3-us-west-2.amazonaws.com/public/imes/category-cards/home-decor.png","url":"/shop/home-living","color":"green","offset":"p5"},{"text":"Posters","ime":"scalable-licensing.s3-us-west-2.amazonaws.com/public/imes/category-cards/wall-posters.png","url":"/shop/home-living/wall-decoration","color":"grey","offset":"1"},{"text":"Phonecases","ime":"scalable-licensing.s3-us-west-2.amazonaws.com/public/imes/category-cards/phone-cases.png","url":"/shop/accessories/phonecases","color":"purple","offset":"p5"}],"featuredCollections":[{"status":"active","sourceType":"storefront","source":"plant-lover-gifts","ime":"scalable-licensing.s3.amazonaws.com/uploads/2019/02/11/5f7be1331f8f9d6e.png","template":"left","sort":"top-selling","allLinkText":{"text":"ShopNow","color":"grey"},"header":{"text":"PlantLover'sGifts","color":"grey"},"description":{"text":"Uniquegiftsforplantlovers!","color":"grey"},"imes":{"mobile":{"size":,"url":"scalable-licensing.s3.amazonaws.com/uploads/banners/2022/04/18/ba412b1.png","fileName":"Vertical-MobileBanner-01.png","dimensions":{"width":750,"height":1200}},"desktop":{"size":,"url":"scalable-licensing.s3.amazonaws.com/uploads/banners/2022/04/18/898c5680aca9b898.png","fileName":"Vertical-DesktopBanner-01.png","dimensions":{"width":992,"height":1516}}},"retailProductCodes":[]},{"status":"active","sourceType":"storefront","source":"fitness-gifts","ime":"scalable-licensing.s3.amazonaws.com/uploads/2019/02/13/cc4d774dc122d81a.jpg","template":"top","sort":"top-selling","allLinkText":{"color":"white","text":"BuyHere"},"header":{"text":"FitnessGifts","color":"white"},"description":{"color":"white","text":"Getreadytosweat!"},"imes":{"mobile":{"size":,"url":"scalable-licensing.s3.amazonaws.com/uploads/banners/2021/05/10/5ebde544d8d97d4f.jpg","fileName":"FitnessGiftsmobile.jpg","dimensions":{"width":750,"height":1200}},"desktop":{"size":,"url":"scalable-licensing.s3.amazonaws.com/uploads/banners/2021/05/10/b5071edb1cdcc0a.jpg","fileName":"FitnessGiftsbanner.jpg","dimensions":{"width":2048,"height":728}}},"retailProductCodes":[]},{"status":"active","sourceType":"storefront","source":"space-gifts","ime":"scalable-licensing.s3.amazonaws.com/uploads/2019/02/15/1e87deec19d.jpg","template":"right","sort":"top-selling","allLinkText":{"color":"white","text":"GetThemHere"},"header":{"text":"CoolSpaceDesigns","color":"white"},"description":{"color":"white","text":"Giftsthatareoutofthisworld!"},"imes":{"mobile":{"size":,"url":"scalable-licensing.s3.amazonaws.com/uploads/banners/2021/03/23/ff5091a2cad89f0d.jpg","fileName":"SpaceDesignsMobile.jpg","dimensions":{"width":750,"height":1200}},"desktop":{"size":,"url":"scalable-licensing.s3.amazonaws.com/uploads/banners/2021/03/23/27e2d4104c8b8100.jpg","fileName":"SpaceDesigns.jpg","dimensions":{"width":992,"height":1516}}},"retailProductCodes":[]}]},"seo":{"domain":{"title":"TeeChip|Customprintsstore|T-shirts,mugs,facemasks,posters","description":"ShopcustomprintedshirtsandapparelonlinewithTeeChip.Buyphonecases,pillowcases&bedding,Mugs,posters,facemasks|ShopCustommerchfromArtists"}},"isRenewable":true,"skipRenewal":false,"skipCharge":true,"domain":"teechip.com","customizations":{"backgroundColors":[],"colors":[],"fonts":[]},"isInternal":true},"retailTrackOrder":{},"retailEditOrder":{},"retailSuggestions":{},"retailFileClaim":{},"retailOrderSearch":{},"categoryMenu":{},"affiliate":{},"vias":{"Entity":{"name":"Entity","docs":{"id":{"587d2247fcdfd4867":{"fetchedAt":"2024-07-16T05:30:51.474Z","doc":{"_id":"587d2247fcdfd4867","trackingTs":{"ts":[]}}}}},"aliases":{"id":"_id"},"listeners":[],"customResults":{"byGroup":{"{\"groupId\":\"587d0d41cee36fd012c64a69\"}":{"alias":"id","result":"587d2247fcdfd4867","meta":{"statusCode":200,"headers":{"date":["Tue,16Jul202405:30:51GMT"],"content-type":["application/json;charset=utf-8"],"content-length":["61"],"connection":["close"],"server":["nginx/1.16.0"],"access-control-allow-origin":["*"],"et":["W/\"3d-Kcc5Xv6F8XxYazz5hBlyW8Y0O/Q\""]}},"fetchedAt":"2024-07-16T05:30:51.474Z"}}},"methods":{},"custom":{"search":{},"retail":{},"byCampaignUrl":{},"byGroup":{}},"cachable":true},"Design":{"name":"Design","docs":{},"aliases":{"id":"_id"},"listeners":[],"customResults":{},"methods":{},"custom":{"find":{}},"cachable":true},"DesignLine":{"name":"DesignLine","docs":{},"aliases":{"id":"_id"},"listeners":[],"customResults":{},"methods":{},"custom":{},"cachable":true},"Discount":{"name":"Discount","docs":{},"aliases":{"id":"_id"},"listeners":[],"customResults":{},"methods":{},"custom":{"bundleByRetailProductId":{},"bundleByCampaignId":{}},"cachable":true},"Product":{"name":"Product","docs":{},"aliases":{"id":"_id","code":"code"},"listeners":[],"customResults":{},"methods":{},"custom":{"byCampaignUrl":{}},"cachable":true},"ProductItem":{"name":"ProductItem","docs":{},"aliases":{},"listeners":[],"customResults":{},"methods":{},"custom":{"byRetailProduct":{}},"cachable":false},"RetailProduct":{"name":"RetailProduct","docs":{},"aliases":{"id":"_id","code":"code"},"listeners":[],"customResults":{},"methods":{},"custom":{"find":{},"byCampaignUrl":{},"relatedProducts":{},"trendingProducts":{}},"cachable":true},"RetailOrder":{"name":"RetailOrder","docs":{},"aliases":{"id":"_id"},"listeners":[],"customResults":{},"methods":{},"custom":{"query":{},"find":{},"userOrders":{},"getById":{}},"cachable":true},"RetailOrderEvent":{"name":"RetailOrderEvent","docs":{},"aliases":{"id":"_id"},"listeners":[],"customResults":{},"methods":{},"custom":{"find":{}},"cachable":true},"Request":{"name":"Request","docs":{},"aliases":{},"listeners":[],"customResults":{},"methods":{},"custom":{"get":{},"post":{},"put":{},"delete":{}},"cachable":false},"RetailPrice":{"name":"RetailPrice","docs":{},"aliases":{"id":"retailProductId"},"listeners":[],"customResults":{},"methods":{},"custom":{},"cachable":true},"Storefront":{"name":"Storefront","docs":{},"aliases":{"id":"_id","url":"url"},"listeners":[],"customResults":{},"methods":{},"custom":{"landing":{},"byT":{},"byCampaignIds":{}},"cachable":true},"Campaign":{"name":"Campaign","docs":{},"aliases":{"id":"_id","url":"url"},"listeners":[],"customResults":{},"methods":{},"custom":{"storefront":{}},"cachable":true},"Collection":{"name":"Collection","docs":{"source":{"plant-lover-gifts":{"fetchedAt":"2024-07-16T05:30:51.388Z","doc":{"status":"active","sourceType":"storefront","source":"plant-lover-gifts","ime":"scalable-licensing.s3.amazonaws.com/uploads/2019/02/11/5f7be1331f8f9d6e.png","template":"left","sort":"top-selling","allLinkText":{"text":"ShopNow","color":"grey"},"header":{"text":"PlantLover'sGifts","color":"grey"},"description":{"text":"Uniquegiftsforplantlovers!","color":"grey"},"imes":{"mobile":{"size":,"url":"scalable-licensing.s3.amazonaws.com/uploads/banners/2022/04/18/ba412b1.png","fileName":"Vertical-MobileBanner-01.png","dimensions":{"width":750,"height":1200}},"desktop":{"size":,"url":"scalable-licensing.s3.amazonaws.com/uploads/banners/2022/04/18/898c5680aca9b898.png","fileName":"Vertical-DesktopBanner-01.png","dimensions":{"width":992,"height":1516}}},"retailProductCodes":[],"result":{"retailProducts":[{"_id":"5fea3dc44acebbec5f","price":2295,"slug":"6262B2AA13F5F7-763CF-GS5-TC0-ASH","designProductCode":"6262B2AA13F5F7-763CF-TC0","code":"6262B2AA13F5F7-763CF-GS5-TC0-ASH","color":"Ash","productId":"587d0d8ff43ea40edad","designLineId":"5fea3dc4a168c93da7dfd2de","designId":"5fea3dc3a168c93da7dfd2dd","entityId":"58d95daa1e9ad5259f","createdAt":"2020-12-28T20:19:16.792Z","imes":[{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-763CF-GS5-TC0-ASH/front","sizes":[{"size":"all"}]},{"name":"back","id":"unisex-crewneck-tshirt-v2-back","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-763CF-GS5-TC0-ASH/back","sizes":[{"size":"all"}]},{"name":"lifestyle-mens-crewneck-front-19","id":"lifestyle-mens-crewneck-front-19","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-763CF-GS5-TC0-ASH/lifestyle-mens-crewneck-front-19","sizes":[{"size":"all"}]}],"ts":{"product":["shirt"],"special":[],"campaign":["cactus-plants","cartoon-cactus","love-plants","plant-lover","plants","succulent"]},"names":{"product":"ClassicT-Shirt","design":"Aloe"},"__v":1,"campaignUrl":"-aloe","campaignId":"5fea3dc6d543a286","storefronts":["plant-lover-gifts"],"related":[{"type":"color","code":"6262B2AA13F5F7-763CF-GS5-TC0-ATH","detail":{"color":"AthleticHeather","names":{"product":"ClassicT-Shirt","design":"Aloe"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-763CF-GS5-TC0-ATH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-763CF-GS5-TC0-GOL","detail":{"color":"Gold","names":{"product":"ClassicT-Shirt","design":"Aloe"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-763CF-GS5-TC0-GOL/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-763CF-GS5-TC0-GRY","detail":{"color":"CharcoalGrey","names":{"product":"ClassicT-Shirt","design":"Aloe"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-763CF-GS5-TC0-GRY/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-763CF-GS5-TC0-KGR","detail":{"color":"Kelly","names":{"product":"ClassicT-Shirt","design":"Aloe"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-763CF-GS5-TC0-KGR/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-763CF-GS5-TC0-LTB","detail":{"color":"LightBlue","names":{"product":"ClassicT-Shirt","design":"Aloe"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-763CF-GS5-TC0-LTB/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-763CF-GS5-TC0-PNK","detail":{"color":"ClassicPink","names":{"product":"ClassicT-Shirt","design":"Aloe"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-763CF-GS5-TC0-PNK/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-763CF-GS5-TC0-WHT","detail":{"color":"White","names":{"product":"ClassicT-Shirt","design":"Aloe"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-763CF-GS5-TC0-WHT/front","sizes":[{"size":"all"}]}}],"defaultImeSide":"front"},{"_id":"5fea670e5cbe3636f0498e45","price":2295,"slug":"6262B2AA13F5F7-DE6B-GS2-TC0-WHT","designProductCode":"6262B2AA13F5F7-DE6B-TC0","code":"6262B2AA13F5F7-DE6B-GS2-TC0-WHT","color":"White","productId":"587d0d8ff43ea40edad","designLineId":"5fea670d6bed16c0","designId":"5fea670d09fb4c3dadb6a83b","entityId":"58d95daa1e9ad5259f","createdAt":"2020-12-28T23:15:26.038Z","imes":[{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-DE6B-GS2-TC0-WHT/front","sizes":[{"size":"all"}]},{"name":"back","id":"unisex-crewneck-tshirt-v2-back","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-DE6B-GS2-TC0-WHT/back","sizes":[{"size":"all"}]},{"name":"lifestyle-mens-crewneck-front-19","id":"lifestyle-mens-crewneck-front-19","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-DE6B-GS2-TC0-WHT/lifestyle-mens-crewneck-front-19","sizes":[{"size":"all"}]}],"ts":{"product":["shirt"],"special":[],"campaign":["cactus-plants","indoor-plants","love-plants","plant-lover","plants","potted-plants"]},"names":{"product":"ClassicT-Shirt","design":"JustOneMorePlant"},"__v":1,"campaignUrl":"just-one-more-plant","campaignId":"5fea670f526b9e473dd","storefronts":["plant-lover-gifts"],"related":[{"type":"color","code":"6262B2AA13F5F7-DE6B-GS2-TC0-ASH","detail":{"color":"Ash","names":{"product":"ClassicT-Shirt","design":"JustOneMorePlant"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-DE6B-GS2-TC0-ASH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-DE6B-GS2-TC0-GOL","detail":{"color":"Gold","names":{"product":"ClassicT-Shirt","design":"JustOneMorePlant"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-DE6B-GS2-TC0-GOL/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-DE6B-GS2-TC0-KGR","detail":{"color":"Kelly","names":{"product":"ClassicT-Shirt","design":"JustOneMorePlant"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-DE6B-GS2-TC0-KGR/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-DE6B-GS2-TC0-LTB","detail":{"color":"LightBlue","names":{"product":"ClassicT-Shirt","design":"JustOneMorePlant"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-DE6B-GS2-TC0-LTB/front","sizes":[{"size":"all"}]}}],"defaultImeSide":"front"},{"_id":"5feb56a699d7f630d1d76ec3","price":2295,"slug":"6262B2AA13F5F7-C5AC4CF-GS0-TC0-ASH","designProductCode":"6262B2AA13F5F7-C5AC4CF-TC0","code":"6262B2AA13F5F7-C5AC4CF-GS0-TC0-ASH","color":"Ash","productId":"587d0d8ff43ea40edad","designLineId":"5feb56a5d72cc2bbc","designId":"5feb56a5959d235c520e8c06","entityId":"58d95daa1e9ad5259f","createdAt":"2020-12-29T16:17:42.652Z","imes":[{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-C5AC4CF-GS0-TC0-ASH/front","sizes":[{"size":"all"}]},{"name":"back","id":"unisex-crewneck-tshirt-v2-back","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-C5AC4CF-GS0-TC0-ASH/back","sizes":[{"size":"all"}]},{"name":"lifestyle-mens-crewneck-front-19","id":"lifestyle-mens-crewneck-front-19","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-C5AC4CF-GS0-TC0-ASH/lifestyle-mens-crewneck-front-19","sizes":[{"size":"all"}]}],"ts":{"product":["shirt"],"special":[],"campaign":["cartoon-plants","i-love-plants","love-plants","nature-lover","plant-lover","plants"]},"names":{"product":"ClassicT-Shirt","design":"PlantsMakemeHappy"},"__v":1,"campaignUrl":"plants-make-me-happy","campaignId":"5feb56a8a3891c519c","storefronts":["plant-lover-gifts"],"related":[{"type":"color","code":"6262B2AA13F5F7-C5AC4CF-GS0-TC0-ATH","detail":{"color":"AthleticHeather","names":{"product":"ClassicT-Shirt","design":"PlantsMakemeHappy"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-C5AC4CF-GS0-TC0-ATH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-C5AC4CF-GS0-TC0-GOL","detail":{"color":"Gold","names":{"product":"ClassicT-Shirt","design":"PlantsMakemeHappy"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-C5AC4CF-GS0-TC0-GOL/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-C5AC4CF-GS0-TC0-KGR","detail":{"color":"Kelly","names":{"product":"ClassicT-Shirt","design":"PlantsMakemeHappy"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-C5AC4CF-GS0-TC0-KGR/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-C5AC4CF-GS0-TC0-LTB","detail":{"color":"LightBlue","names":{"product":"ClassicT-Shirt","design":"PlantsMakemeHappy"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-C5AC4CF-GS0-TC0-LTB/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-C5AC4CF-GS0-TC0-WHT","detail":{"color":"White","names":{"product":"ClassicT-Shirt","design":"PlantsMakemeHappy"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-C5AC4CF-GS0-TC0-WHT/front","sizes":[{"size":"all"}]}}],"defaultImeSide":"front"},{"_id":"5fea5ab64acebbece7","price":2295,"slug":"6262B2AA13F5F7-F3290CB-GS1-TC0-WHT","designProductCode":"6262B2AA13F5F7-F3290CB-TC0","code":"6262B2AA13F5F7-F3290CB-GS1-TC0-WHT","color":"White","productId":"587d0d8ff43ea40edad","designLineId":"5fea5ab49bae5f3da","designId":"5fea5ab41e46d93e3f54a05f","entityId":"58d95daa1e9ad5259f","createdAt":"2020-12-28T22:22:46.511Z","imes":[{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-F3290CB-GS1-TC0-WHT/front","sizes":[{"size":"all"}]},{"name":"back","id":"unisex-crewneck-tshirt-v2-back","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-F3290CB-GS1-TC0-WHT/back","sizes":[{"size":"all"}]},{"name":"lifestyle-mens-crewneck-front-19","id":"lifestyle-mens-crewneck-front-19","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-F3290CB-GS1-TC0-WHT/lifestyle-mens-crewneck-front-19","sizes":[{"size":"all"}]}],"ts":{"product":["shirt"],"special":[],"campaign":["Gardening","Hobbies","i-love-plants","nature-lover","plant-lover","plants"]},"names":{"product":"ClassicT-Shirt","design":"PlantsAreHappiness"},"__v":1,"campaignUrl":"plants-are-happiness","campaignId":"5fea5ab6b773af0a240","storefronts":["plant-lover-gifts"],"related":[{"type":"color","code":"6262B2AA13F5F7-F3290CB-GS1-TC0-ASH","detail":{"color":"Ash","names":{"product":"ClassicT-Shirt","design":"PlantsAreHappiness"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-F3290CB-GS1-TC0-ASH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-F3290CB-GS1-TC0-ATH","detail":{"color":"AthleticHeather","names":{"product":"ClassicT-Shirt","design":"PlantsAreHappiness"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-F3290CB-GS1-TC0-ATH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-F3290CB-GS1-TC0-LTB","detail":{"color":"LightBlue","names":{"product":"ClassicT-Shirt","design":"PlantsAreHappiness"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-F3290CB-GS1-TC0-LTB/front","sizes":[{"size":"all"}]}}],"defaultImeSide":"front"}],"meta":{"pes":40,"count":160,"filters":{"product":[{"name":"canvas-wrap-print","count":40},{"name":"shirt","count":30},{"name":"pillowcase","count":20},{"name":"case","count":10},{"name":"hoodie","count":10},{"name":"mug","count":10},{"name":"sticker","count":10},{"name":"sweatshirt","count":10},{"name":"tanktop","count":10},{"name":"tumbler","count":10}],"color":[{"name":"white","count":160},{"name":"grey","count":87},{"name":"blue","count":68},{"name":"green","count":37},{"name":"pink","count":22},{"name":"blue-dark","count":21},{"name":"green-dark","count":19},{"name":"gold","count":17},{"name":"yellow","count":16},{"name":"black","count":9},{"name":"purple","count":6},{"name":"orange","count":3}],"department":[{"name":"housewares","count":80},{"name":"women","count":50},{"name":"men","count":40},{"name":"accessories","count":20}],"price":[{"name":"*-1000.0","count":10},{"name":"1000.0-2000.0","count":20},{"name":"2000.0-4000.0","count":80},{"name":"4000.0-6000.0","count":50}],"style":[{"name":"plant-lover","count":160},{"name":"plants","count":160},{"name":"love-plants","count":128},{"name":"nature-lover","count":96},{"name":"Gardening","count":64},{"name":"Hobbies","count":64},{"name":"cactus-plants","count":64},{"name":"cartoon-cactus","count":48},{"name":"i-love-plants","count":48},{"name":"plant-quotes","count":48},{"name":"cartoon-plants","count":32},{"name":"indoor-plants","count":16},{"name":"potted-plants","count":16},{"name":"succulent","count":16}]}}}}},"fitness-gifts":{"fetchedAt":"2024-07-16T05:30:51.388Z","doc":{"status":"active","sourceType":"storefront","source":"fitness-gifts","ime":"scalable-licensing.s3.amazonaws.com/uploads/2019/02/13/cc4d774dc122d81a.jpg","template":"top","sort":"top-selling","allLinkText":{"color":"white","text":"BuyHere"},"header":{"text":"FitnessGifts","color":"white"},"description":{"color":"white","text":"Getreadytosweat!"},"imes":{"mobile":{"size":,"url":"scalable-licensing.s3.amazonaws.com/uploads/banners/2021/05/10/5ebde544d8d97d4f.jpg","fileName":"FitnessGiftsmobile.jpg","dimensions":{"width":750,"height":1200}},"desktop":{"size":,"url":"scalable-licensing.s3.amazonaws.com/uploads/banners/2021/05/10/b5071edb1cdcc0a.jpg","fileName":"FitnessGiftsbanner.jpg","dimensions":{"width":2048,"height":728}}},"retailProductCodes":[],"result":{"retailProducts":[{"_id":"6050bef83dd1d1d328","price":2295,"slug":"6262B2AA13F5F7-4E801CA-GS1-TC0-BLK","designProductCode":"6262B2AA13F5F7-4E801CA-TC0","code":"6262B2AA13F5F7-4E801CA-GS1-TC0-BLK","color":"Black","productId":"587d0d8ff43ea40edad","designLineId":"6050bef7a7510c0abb","designId":"6050befaa8eb42ff","entityId":"58d95daa1e9ad5259f","createdAt":"2021-03-16T14:21:44.447Z","imes":[{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-4E801CA-GS1-TC0-BLK/front","sizes":[{"size":"all"}]},{"name":"back","id":"unisex-crewneck-tshirt-v2-back","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-4E801CA-GS1-TC0-BLK/back","sizes":[{"size":"all"}]},{"name":"apparel-classic-tshirt-lifestyle-18","id":"apparel-classic-tshirt-lifestyle-18","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-4E801CA-GS1-TC0-BLK/apparel-classic-tshirt-lifestyle-18","sizes":[{"size":"all"}]},{"name":"apparel-classic-tshirt-lifestyle-front-45","id":"apparel-classic-tshirt-lifestyle-front-45","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-4E801CA-GS1-TC0-BLK/apparel-classic-tshirt-lifestyle-front-45","sizes":[{"size":"all"}]}],"ts":{"product":["shirt"],"campaign":["Powerlifting","Sports","StrengthSports","Strongman","Weightlifting","fitness"]},"names":{"product":"ClassicT-Shirt","design":"SquatBenchDeadliftRepeat"},"__v":0,"campaignUrl":"squatbenchdeadliftrepeat","campaignId":"6050bef948cb7512bdea4d35","storefronts":["fitness-gifts"],"related":[{"type":"color","code":"6262B2AA13F5F7-4E801CA-GS1-TC0-ASH","detail":{"color":"Ash","names":{"product":"ClassicT-Shirt","design":"SquatBenchDeadliftRepeat"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-4E801CA-GS1-TC0-ASH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-4E801CA-GS1-TC0-ATH","detail":{"color":"AthleticHeather","names":{"product":"ClassicT-Shirt","design":"SquatBenchDeadliftRepeat"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-4E801CA-GS1-TC0-ATH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-4E801CA-GS1-TC0-GRY","detail":{"color":"CharcoalGrey","names":{"product":"ClassicT-Shirt","design":"SquatBenchDeadliftRepeat"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-4E801CA-GS1-TC0-GRY/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-4E801CA-GS1-TC0-N","detail":{"color":"JNy","names":{"product":"ClassicT-Shirt","design":"SquatBenchDeadliftRepeat"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-4E801CA-GS1-TC0-N/front","sizes":[{"size":"all"}]}}],"defaultImeSide":"front"},{"_id":"6050bf6e09d60c73f9","price":2295,"slug":"6262B2AA13F5F7-B6CA-GS0-TC0-N","designProductCode":"6262B2AA13F5F7-B6CA-TC0","code":"6262B2AA13F5F7-B6CA-GS0-TC0-N","color":"JNy","productId":"587d0d8ff43ea40edad","designLineId":"6050b443ac5d4b310e","designId":"6050b92b3ccd728b","entityId":"58d95daa1e9ad5259f","createdAt":"2021-03-16T13:36:03.614Z","imes":[{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-GS0-TC0-N/front","sizes":[{"size":"all"}]},{"name":"back","id":"unisex-crewneck-tshirt-v2-back","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-GS0-TC0-N/back","sizes":[{"size":"all"}]},{"name":"apparel-classic-tshirt-lifestyle-front-33","id":"apparel-classic-tshirt-lifestyle-front-33","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-GS0-TC0-N/apparel-classic-tshirt-lifestyle-front-33","sizes":[{"size":"all"}]},{"name":"apparel-classic-tshirt-lifestyle-front-42","id":"apparel-classic-tshirt-lifestyle-front-42","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-GS0-TC0-N/apparel-classic-tshirt-lifestyle-front-42","sizes":[{"size":"all"}]}],"ts":{"product":["shirt"],"campaign":["Jobs","Sports&Fitness","YogaInstructor","fitness","yoga","yoga-clothes"]},"names":{"product":"ClassicT-Shirt","design":"InhaleExhale"},"__v":0,"campaignUrl":"ujjayi","campaignId":"6050beddb13bf","storefronts":["fitness-gifts"],"related":[{"type":"color","code":"6262B2AA13F5F7-B6CA-GS0-TC0-ATH","detail":{"color":"AthleticHeather","names":{"product":"ClassicT-Shirt","design":"InhaleExhale"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-GS0-TC0-ATH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-B6CA-GS0-TC0-BLK","detail":{"color":"Black","names":{"product":"ClassicT-Shirt","design":"InhaleExhale"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-GS0-TC0-BLK/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-B6CA-GS0-TC0-GRY","detail":{"color":"CharcoalGrey","names":{"product":"ClassicT-Shirt","design":"InhaleExhale"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-GS0-TC0-GRY/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-B6CA-GS0-TC0-LTB","detail":{"color":"LightBlue","names":{"product":"ClassicT-Shirt","design":"InhaleExhale"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-GS0-TC0-LTB/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-B6CA-GS0-TC0-PUR","detail":{"color":"Purple","names":{"product":"ClassicT-Shirt","design":"InhaleExhale"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-GS0-TC0-PUR/front","sizes":[{"size":"all"}]}}],"defaultImeSide":"front"},{"_id":"604fb9a77fc9e193","price":2295,"slug":"6262B2AA13F5F7-FD3A-GS4-TC0-GRY","designProductCode":"6262B2AA13F5F7-FD3A-TC0","code":"6262B2AA13F5F7-FD3A-GS4-TC0-GRY","color":"CharcoalGrey","productId":"587d0d8ff43ea40edad","designLineId":"604fb9a78ca2782b48f3c7c5","designId":"604fb9ab3ccd60ca","entityId":"58d95daa1e9ad5259f","createdAt":"2021-03-15T19:46:47.503Z","imes":[{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-FD3A-GS4-TC0-GRY/front","sizes":[{"size":"all"}]},{"name":"back","id":"unisex-crewneck-tshirt-v2-back","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-FD3A-GS4-TC0-GRY/back","sizes":[{"size":"all"}]},{"name":"apparel-classic-tshirt-lifestyle-18","id":"apparel-classic-tshirt-lifestyle-18","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-FD3A-GS4-TC0-GRY/apparel-classic-tshirt-lifestyle-18","sizes":[{"size":"all"}]},{"name":"apparel-classic-tshirt-lifestyle-front-40","id":"apparel-classic-tshirt-lifestyle-front-40","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-FD3A-GS4-TC0-GRY/apparel-classic-tshirt-lifestyle-front-40","sizes":[{"size":"all"}]}],"ts":{"product":["shirt"],"campaign":["Fitness&Gym","Interests","Lifestyle","Sports","StrengthSports","WeightTraining"]},"names":{"product":"ClassicT-Shirt","design":"ShutupandSquat"},"__v":0,"campaignUrl":"shut-up-squat","campaignId":"604fb9a851bda23ab6","storefronts":["fitness-gifts"],"related":[{"type":"color","code":"6262B2AA13F5F7-FD3A-GS4-TC0-ASH","detail":{"color":"Ash","names":{"product":"ClassicT-Shirt","design":"ShutupandSquat"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-FD3A-GS4-TC0-ASH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-FD3A-GS4-TC0-ATH","detail":{"color":"AthleticHeather","names":{"product":"ClassicT-Shirt","design":"ShutupandSquat"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-FD3A-GS4-TC0-ATH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-FD3A-GS4-TC0-BLK","detail":{"color":"Black","names":{"product":"ClassicT-Shirt","design":"ShutupandSquat"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-FD3A-GS4-TC0-BLK/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-FD3A-GS4-TC0-CPK","detail":{"color":"CyberPink","names":{"product":"ClassicT-Shirt","design":"ShutupandSquat"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-FD3A-GS4-TC0-CPK/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-FD3A-GS4-TC0-LTB","detail":{"color":"LightBlue","names":{"product":"ClassicT-Shirt","design":"ShutupandSquat"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-FD3A-GS4-TC0-LTB/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-FD3A-GS4-TC0-N","detail":{"color":"JNy","names":{"product":"ClassicT-Shirt","design":"ShutupandSquat"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-FD3A-GS4-TC0-N/front","sizes":[{"size":"all"}]}}],"defaultImeSide":"front"},{"_id":"6050b4444dd6307b","price":4995,"slug":"6262B2AA13F5F7-B6CA-S3YM27V3-CG116-LTB","designProductCode":"6262B2AA13F5F7-B6CA-CG116","code":"6262B2AA13F5F7-B6CA-S3YM27V3-CG116-LTB","color":"LightBlue","productId":"5eaaf7dde4ca2aaea","designLineId":"6050bab697d0","designId":"6050b92b3ccd728b","entityId":"58d95daa1e9ad5259f","createdAt":"2021-03-16T13:36:04.519Z","imes":[{"name":"front","id":"aos-yoga-mat-24x70-front-01","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-LTB/front","sizes":[{"size":"all"}]},{"name":"aos-yoga-mat-lifestyle-03","id":"aos-yoga-mat-lifestyle-03","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-LTB/aos-yoga-mat-lifestyle-03","sizes":[{"size":"all"}]},{"name":"aos-yoga-mat-lifestyle-17","id":"aos-yoga-mat-lifestyle-17","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-LTB/aos-yoga-mat-lifestyle-17","sizes":[{"size":"all"}]},{"name":"aos-yoga-mat-lifestyle-21","id":"aos-yoga-mat-lifestyle-21","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-LTB/aos-yoga-mat-lifestyle-21","sizes":[{"size":"all"}]},{"name":"aos-yoga-mat-lifestyle-23","id":"aos-yoga-mat-lifestyle-23","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-LTB/aos-yoga-mat-lifestyle-23","sizes":[{"size":"all"}]},{"name":"aos-yoga-mat-lifestyle-29","id":"aos-yoga-mat-lifestyle-29","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-LTB/aos-yoga-mat-lifestyle-29","sizes":[{"size":"all"}]},{"name":"aos-yoga-mat-lifestyle-30","id":"aos-yoga-mat-lifestyle-30","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-LTB/aos-yoga-mat-lifestyle-30","sizes":[{"size":"all"}]},{"name":"aos-yoga-mat-lifestyle-32","id":"aos-yoga-mat-lifestyle-32","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-LTB/aos-yoga-mat-lifestyle-32","sizes":[{"size":"all"}]}],"ts":{"product":["yoga-mat"],"campaign":["Jobs","Sports&Fitness","YogaInstructor","fitness","yoga","yoga-clothes"]},"names":{"product":"YogaMat24x70(vertical)","design":"InhaleExhale"},"__v":0,"campaignUrl":"ujjayi","campaignId":"6050beddb13bf","storefronts":["fitness-gifts"],"related":[{"type":"color","code":"6262B2AA13F5F7-B6CA-S3YM27V3-CG116-ASH","detail":{"color":"Ash","names":{"product":"YogaMat24x70(vertical)","design":"InhaleExhale"}},"ime":{"name":"front","id":"aos-yoga-mat-24x70-front-01","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-ASH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-B6CA-S3YM27V3-CG116-BLK","detail":{"color":"Black","names":{"product":"YogaMat24x70(vertical)","design":"InhaleExhale"}},"ime":{"name":"front","id":"aos-yoga-mat-24x70-front-01","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-BLK/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-B6CA-S3YM27V3-CG116-CPK","detail":{"color":"CyberPink","names":{"product":"YogaMat24x70(vertical)","design":"InhaleExhale"}},"ime":{"name":"front","id":"aos-yoga-mat-24x70-front-01","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-CPK/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-B6CA-S3YM27V3-CG116-GRY","detail":{"color":"CharcoalGrey","names":{"product":"YogaMat24x70(vertical)","design":"InhaleExhale"}},"ime":{"name":"front","id":"aos-yoga-mat-24x70-front-01","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-GRY/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-B6CA-S3YM27V3-CG116-N","detail":{"color":"JNy","names":{"product":"YogaMat24x70(vertical)","design":"InhaleExhale"}},"ime":{"name":"front","id":"aos-yoga-mat-24x70-front-01","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-N/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-B6CA-S3YM27V3-CG116-PNK","detail":{"color":"ClassicPink","names":{"product":"YogaMat24x70(vertical)","design":"InhaleExhale"}},"ime":{"name":"front","id":"aos-yoga-mat-24x70-front-01","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-PNK/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-B6CA-S3YM27V3-CG116-PUR","detail":{"color":"Purple","names":{"product":"YogaMat24x70(vertical)","design":"InhaleExhale"}},"ime":{"name":"front","id":"aos-yoga-mat-24x70-front-01","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-B6CA-S3YM27V3-CG116-PUR/front","sizes":[{"size":"all"}]}}],"defaultImeSide":"front"}],"meta":{"pes":30,"count":117,"filters":{"product":[{"name":"shirt","count":32},{"name":"tanktop","count":18},{"name":"drawstring","count":9},{"name":"hoodie","count":9},{"name":"longsleeve","count":9},{"name":"mug","count":9},{"name":"neck-gaiter","count":9},{"name":"sweatshirt","count":9},{"name":"hat","count":8},{"name":"yoga-mat","count":3},{"name":"sock","count":2}],"color":[{"name":"black","count":117},{"name":"grey","count":99},{"name":"blue-dark","count":73},{"name":"white","count":35},{"name":"blue","count":34},{"name":"pink","count":14},{"name":"purple","count":9},{"name":"brown","count":6},{"name":"green-dark","count":6},{"name":"green","count":2}],"department":[{"name":"women","count":70},{"name":"men","count":52},{"name":"accessories","count":31},{"name":"housewares","count":9}],"price":[{"name":"1000.0-2000.0","count":27},{"name":"2000.0-4000.0","count":78},{"name":"4000.0-6000.0","count":12}],"style":[{"name":"Interests","count":90},{"name":"fitness","count":82},{"name":"Fitness&Gym","count":76},{"name":"Lifestyle","count":76},{"name":"Sports","count":38},{"name":"StrengthSports","count":38},{"name":"fitness-clothing","count":28},{"name":"Weightlifting","count":25},{"name":"Jobs","count":24},{"name":"Sports&Fitness","count":24},{"name":"Beveres","count":14},{"name":"Coffee","count":14},{"name":"Powerlifting","count":14},{"name":"Strongman","count":14},{"name":"coffee-lover","count":14},{"name":"exercise-clothes","count":14},{"name":"WeightLoss","count":13},{"name":"WeightTraining","count":13},{"name":"YogaInstructor","count":13},{"name":"gym-outfit","count":13},{"name":"yoga","count":13},{"name":"yoga-clothes","count":13},{"name":"Nutritionist","count":11}]}}}}},"space-gifts":{"fetchedAt":"2024-07-16T05:30:51.388Z","doc":{"status":"active","sourceType":"storefront","source":"space-gifts","ime":"scalable-licensing.s3.amazonaws.com/uploads/2019/02/15/1e87deec19d.jpg","template":"right","sort":"top-selling","allLinkText":{"color":"white","text":"GetThemHere"},"header":{"text":"CoolSpaceDesigns","color":"white"},"description":{"color":"white","text":"Giftsthatareoutofthisworld!"},"imes":{"mobile":{"size":,"url":"scalable-licensing.s3.amazonaws.com/uploads/banners/2021/03/23/ff5091a2cad89f0d.jpg","fileName":"SpaceDesignsMobile.jpg","dimensions":{"width":750,"height":1200}},"desktop":{"size":,"url":"scalable-licensing.s3.amazonaws.com/uploads/banners/2021/03/23/27e2d4104c8b8100.jpg","fileName":"SpaceDesigns.jpg","dimensions":{"width":992,"height":1516}}},"retailProductCodes":[],"result":{"retailProducts":[{"_id":"603dcb372feaf51f9","price":2295,"slug":"6262B2AA13F5F7-E77E-GS1-TC0-WHT","designProductCode":"6262B2AA13F5F7-E77E-TC0","code":"6262B2AA13F5F7-E77E-GS1-TC0-WHT","color":"White","productId":"587d0d8ff43ea40edad","designLineId":"603dcbc071a27a7066","designId":"603dcb369a07ee1b0e","entityId":"58d95daa1e9ad5259f","createdAt":"2021-03-02T05:20:55.226Z","imes":[{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-E77E-GS1-TC0-WHT/front","sizes":[{"size":"all"}]},{"name":"back","id":"unisex-crewneck-tshirt-v2-back","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-E77E-GS1-TC0-WHT/back","sizes":[{"size":"all"}]},{"name":"apparel-classic-tshirt-lifestyle-front-50","id":"apparel-classic-tshirt-lifestyle-front-50","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-E77E-GS1-TC0-WHT/apparel-classic-tshirt-lifestyle-front-50","sizes":[{"size":"all"}]},{"name":"apparel-classic-tshirt-lifestyle-front-164","id":"apparel-classic-tshirt-lifestyle-front-164","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-E77E-GS1-TC0-WHT/apparel-classic-tshirt-lifestyle-front-164","sizes":[{"size":"all"}]}],"ts":{"product":["shirt"],"campaign":[]},"names":{"product":"ClassicT-Shirt","design":"ReadyForAbduction"},"__v":0,"campaignUrl":"ready-for-abduction","campaignId":"603dcb38fe4fbafa6e7","storefronts":["space-gifts"],"related":[{"type":"color","code":"6262B2AA13F5F7-E77E-GS1-TC0-ASH","detail":{"color":"Ash","names":{"product":"ClassicT-Shirt","design":"ReadyForAbduction"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-E77E-GS1-TC0-ASH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-E77E-GS1-TC0-KWG","detail":{"color":"Kiwi","names":{"product":"ClassicT-Shirt","design":"ReadyForAbduction"}},"ime":{"name":"front","id":"unisex-crewneck-tshirt-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-E77E-GS1-TC0-KWG/front","sizes":[{"size":"all"}]}}],"defaultImeSide":"front"},{"_id":"603e6b4eb59ddb2c676","price":4295,"slug":"6262B2AA13F5F7-A-GS0-TC4-WHT","designProductCode":"6262B2AA13F5F7-A-TC4","code":"6262B2AA13F5F7-A-GS0-TC4-WHT","color":"White","productId":"587d0d8ff43ea40edb1","designLineId":"603e6b4e51d5df71ae","designId":"603e6b4d5234c071a27a7bc5","entityId":"58d95daa1e9ad5259f","createdAt":"2021-03-02T16:43:58.932Z","imes":[{"name":"front","id":"unisex-hoodie-v2-front","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-A-GS0-TC4-WHT/front","sizes":[{"size":"all"}]},{"name":"back","id":"unisex-hoodie-v2-back","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-A-GS0-TC4-WHT/back","sizes":[{"size":"all"}]},{"name":"apparel-hooded-sweatshirt-lifestyle-03","id":"apparel-hooded-sweatshirt-lifestyle-03","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-A-GS0-TC4-WHT/apparel-hooded-sweatshirt-lifestyle-03","sizes":[{"size":"all"}]},{"name":"apparel-hooded-sweatshirt-lifestyle-front-53","id":"apparel-hooded-sweatshirt-lifestyle-front-53","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-A-GS0-TC4-WHT/apparel-hooded-sweatshirt-lifestyle-front-53","sizes":[{"size":"all"}]}],"ts":{"product":["hoodie"],"campaign":[]},"names":{"product":"HoodedSweatshirt","design":"MilkyWay"},"__v":0,"campaignUrl":"milky-way","campaignId":"603e6b503d1adf017","storefronts":["space-gifts"],"related":[],"defaultImeSide":"front"},{"_id":"603e8b2e2d1d0a68","price":3695,"slug":"6262B2AA13F5F7-522B-S3T2O12-DB100-N","designProductCode":"6262B2AA13F5F7-522B-DB100","code":"6262B2AA13F5F7-522B-S3T2O12-DB100-N","color":"JNy","productId":"5f45bdf98eb6","designLineId":"603e8b2b33a56b1a47b60b5a","designId":"603e8b2a4f2ea4189b8d36c3","entityId":"58d95daa1e9ad5259f","createdAt":"2021-03-02T18:59:58.665Z","imes":[{"name":"front","id":"aos-20oz-tumbler-ghosted-front-01","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-522B-S3T2O12-DB100-N/front","sizes":[{"size":"all"}]},{"name":"aos-20oz-tumbler-lifestyle-front-14","id":"aos-20oz-tumbler-lifestyle-front-14","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-522B-S3T2O12-DB100-N/aos-20oz-tumbler-lifestyle-front-14","sizes":[{"size":"all"}]},{"name":"aos-20oz-tumbler-lifestyle-front-20","id":"aos-20oz-tumbler-lifestyle-front-20","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-522B-S3T2O12-DB100-N/aos-20oz-tumbler-lifestyle-front-20","sizes":[{"size":"all"}]}],"ts":{"product":["tumbler"],"campaign":[]},"names":{"product":"20ozTumbler","design":"SpaceApe"},"__v":0,"campaignUrl":"space-ape","campaignId":"603e8b2f63ec3ed000c","storefronts":["space-gifts"],"related":[{"type":"color","code":"6262B2AA13F5F7-522B-S3T2O12-DB100-ASH","detail":{"color":"Ash","names":{"product":"20ozTumbler","design":"SpaceApe"}},"ime":{"name":"front","id":"aos-20oz-tumbler-ghosted-front-01","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-522B-S3T2O12-DB100-ASH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-522B-S3T2O12-DB100-BLK","detail":{"color":"Black","names":{"product":"20ozTumbler","design":"SpaceApe"}},"ime":{"name":"front","id":"aos-20oz-tumbler-ghosted-front-01","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-522B-S3T2O12-DB100-BLK/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-522B-S3T2O12-DB100-PUR","detail":{"color":"Purple","names":{"product":"20ozTumbler","design":"SpaceApe"}},"ime":{"name":"front","id":"aos-20oz-tumbler-ghosted-front-01","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-522B-S3T2O12-DB100-PUR/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-522B-S3T2O12-DB100-WHT","detail":{"color":"White","names":{"product":"20ozTumbler","design":"SpaceApe"}},"ime":{"name":"front","id":"aos-20oz-tumbler-ghosted-front-01","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-522B-S3T2O12-DB100-WHT/front","sizes":[{"size":"all"}]}}],"defaultImeSide":"front"},{"_id":"603e9aa163aec9136dcbe86d","price":2995,"slug":"6262B2AA13F5F7-F3551CB-SPS2-S61-WHT","designProductCode":"6262B2AA13F5F7-F3551CB-S61","code":"6262B2AA13F5F7-F3551CB-SPS2-S61-WHT","color":"White","productId":"5ac7ac4c06a2c2184d11ef78","designLineId":"603e9a9f4f76eec8ae6","designId":"603e9a9f407cd0d756","entityId":"58d95daa1e9ad5259f","createdAt":"2021-03-02T20:05:53.283Z","imes":[{"name":"front","id":"aos-pillow-square-front-1","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-F3551CB-SPS2-S61-WHT/front","sizes":[{"size":"all"}]},{"name":"back","id":"aos-pillow-square-back-1","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-F3551CB-SPS2-S61-WHT/back","sizes":[{"size":"all"}]},{"name":"aos-pillow-square-front-lifestyle-04","id":"aos-pillow-square-front-lifestyle-04","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-F3551CB-SPS2-S61-WHT/aos-pillow-square-front-lifestyle-04","sizes":[{"size":"all"}]}],"ts":{"product":["pillowcase"],"campaign":[]},"names":{"product":"SquarePillowcase","design":"TeamMars"},"__v":0,"campaignUrl":"team-mars-01","campaignId":"603e9aa38f6abf3ce2","storefronts":["space-gifts"],"related":[{"type":"color","code":"6262B2AA13F5F7-F3551CB-SPS2-S61-ASH","detail":{"color":"Ash","names":{"product":"SquarePillowcase","design":"TeamMars"}},"ime":{"name":"front","id":"aos-pillow-square-front-1","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-F3551CB-SPS2-S61-ASH/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-F3551CB-SPS2-S61-BLK","detail":{"color":"Black","names":{"product":"SquarePillowcase","design":"TeamMars"}},"ime":{"name":"front","id":"aos-pillow-square-front-1","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-F3551CB-SPS2-S61-BLK/front","sizes":[{"size":"all"}]}},{"type":"color","code":"6262B2AA13F5F7-F3551CB-SPS2-S61-RED","detail":{"color":"TrueRed","names":{"product":"SquarePillowcase","design":"TeamMars"}},"ime":{"name":"front","id":"aos-pillow-square-front-1","prefix":"cdn.32pt.com/public/sl-prod-od-0/imes/retail-products/6262B2AA13F5F7/6262B2AA13F5F7-F3551CB-SPS2-S61-RED/front","sizes":[{"size":"all"}]}}],"defaultImeSide":"front"}],"meta":{"pes":53,"count":211,"filters":{"product":[{"name":"shirt","count":40},{"name":"pillowcase","count":22},{"name":"canvas-wrap-print","count":20},{"name":"duvet","count":20},{"name":"sticker","count":20},{"name":"case","count":11},{"name":"tanktop","count":11},{"name":"hoodie","count":10},{"name":"mousepad","count":10},{"name":"mug","count":10},{"name":"puzzle","count":10},{"name":"tapestry","count":10},{"name":"tumbler","count":10},{"name":"bracelet","count":2},{"name":"coaster","count":2},{"name":"necklace","count":2},{"name":"dress","count":1}],"color":[{"name":"white","count":182},{"name":"black","count":103},{"name":"grey","count":101},{"name":"blue-dark","count":54},{"name":"purple","count":36},{"name":"blue","count":20},{"name":"red","count":17},{"name":"green-dark","count":16},{"name":"gold","count":15},{"name":"green","count":7},{"name":"yellow","count":6},{"name":"brown","count":1}],"department":[{"name":"housewares","count":104},{"name":"women","count":52},{"name":"accessories","count":41},{"name":"men","count":41},{"name":"jewelry","count":4}],"price":[{"name":"*-1000.0","count":10},{"name":"1000.0-2000.0","count":38},{"name":"2000.0-4000.0","count":103},{"name":"4000.0-6000.0","count":40},{"name":"6000.0-*","count":20}],"style":[{"name":"Personality&Traits","count":11},{"name":"SciFi","count":11},{"name":"astronaut","count":11},{"name":"sci-fi-art","count":11},{"name":"scifi-movies","count":11},{"name":"space","count":11}]}}}}}}},"aliases":{"source":"source"},"listeners":[],"customResults":{"featuredCollections":{"{\"featuredCollections\":[{\"allLinkText\":{\"color\":\"grey\",\"text\":\"ShopNow\"},\"description\":{\"color\":\"grey\",\"text\":\"Uniquegiftsforplantlovers!\"},\"header\":{\"color\":\"grey\",\"text\":\"PlantLover'sGifts\"},\"ime\":\"scalable-licensing.s3.amazonaws.com/uploads/2019/02/11/5f7be1331f8f9d6e.png\",\"imes\":{\"desktop\":{\"dimensions\":{\"height\":1516,\"width\":992},\"fileName\":\"Vertical-DesktopBanner-01.png\",\"size\":,\"url\":\"scalable-licensing.s3.amazonaws.com/uploads/banners/2022/04/18/898c5680aca9b898.png\"},\"mobile\":{\"dimensions\":{\"height\":1200,\"width\":750},\"fileName\":\"Vertical-MobileBanner-01.png\",\"size\":,\"url\":\"scalable-licensing.s3.amazonaws.com/uploads/banners/2022/04/18/ba412b1.png\"}},\"retailProductCodes\":],\"sort\":\"top-selling\",\"source\":\"plant-lover-gifts\",\"sourceType\":\"storefront\",\"status\":\"active\",\"template\":\"left\"},{\"allLinkText\":{\"color\":\"white\",\"text\":\"BuyHere\"},\"description\":{\"color\":\"white\",\"text\":\"Getreadytosweat!\"},\"header\":{\"color\":\"white\",\"text\":\"FitnessGifts\"},\"ime\":\"scalable-licensing.s3.amazonaws.com/uploads/2019/02/13/cc4d774dc122d81a.jpg\",\"imes\":{\"desktop\":{\"dimensions\":{\"height\":728,\"width\":2048},\"fileName\":\"FitnessGiftsbanner.jpg\",\"size\":,\"url\":\"scalable-licensing.s3.amazonaws.com/uploads/banners/2021/05/10/b5071edb1cdcc0a.jpg\"},\"mobile\":{\"dimensions\":{\"height\":1200,\"width\":750},\"fileName\":\"FitnessGiftsmobile.jpg\",\"size\":,\"url\":\"scalable-licensing.s3.amazonaws.com/uploads/banners/2021/05/10/5ebde544d8d97d4f.jpg\"}},\"retailProductCodes\":],\"sort\":\"top-selling\",\"source\":\"fitness-gifts\",\"sourceType\":\"storefront\",\"status\":\"active\",\"template\":\"top\"},{\"allLinkText\":{\"color\":\"white\",\"text\":\"GetThemHere\"},\"description\":{\"color\":\"white\",\"text\":\"Giftsthatareoutofthisworld!\"},\"header\":{\"color\":\"white\",\"text\":\"CoolSpaceDesigns\"},\"ime\":\"scalable-licensing.s3.amazonaws.com/uploads/2019/02/15/1e87deec19d.jpg\",\"imes\":{\"desktop\":{\"dimensions\":{\"height\":1516,\"width\":992},\"fileName\":\"SpaceDesigns.jpg\",\"size\":,\"url\":\"scalable-licensing.s3.amazonaws.com/uploads/banners/2021/03/23/27e2d4104c8b8100.jpg\"},\"mobile\":{\"dimensions\":{\"height\":1200,\"width\":750},\"fileName\":\"SpaceDesignsMobile.jpg\",\"size\":,\"url\":\"scalable-licensing.s3.amazonaws.com/uploads/banners/2021/03/23/ff5091a2cad89f0d.jpg\"}},\"retailProductCodes\":],\"sort\":\"top-selling\",\"source\":\"space-gifts\",\"sourceType\":\"storefront\",\"status\":\"active\",\"template\":\"right\"}]}":{"alias":"source","result":["plant-lover-gifts","fitness-gifts","space-gifts"],"fetchedAt":"2024-07-16T05:30:51.388Z"}}},"methods":{},"custom":{"featuredCollections":{}},"cachable":true},"RetailCoupon":{"name":"RetailCoupon","docs":{},"aliases":{"code":"code","id":"_id"},"listeners":[],"customResults":{},"methods":{},"custom":{},"cachable":true},"RetailBundle":{"name":"RetailBundle","docs":{},"aliases":{},"listeners":[],"customResults":{},"methods":{},"custom":{"byRetailOrderId":{}},"cachable":false},"CampaignProduct":{"name":"CampaignProduct","docs":{},"aliases":{"id":"_id","code":"code"},"listeners":[],"customResults":{},"methods":{},"custom":{"storefront":{},"find":{},"t":{},"shop":{},"trendingProducts":{}},"cachable":true},"T":{"name":"T","docs":{},"aliases":{"slug":"slug"},"listeners":[],"customResults":{},"methods":{},"custom":{"path":{},"format":{}},"cachable":true},"Analytics":{"name":"Analytics","docs":{"id":{"fd4b238a623b39c669":{"fetchedAt":"2024-07-16T05:30:51.385Z","doc":{"_id":"fd4b238a623b39c669","data":{"popularTs":[{"slug":"1980s","name":"1980s"},{"slug":"1990s","name":"1990s"},{"slug":"Action&Adventure","name":"Action&Adventure"},{"slug":"Activism","name":"Activism"},{"slug":"AfricanAmerican","name":"AfricanAmerican"},{"slug":"e","name":"e"},{"slug":"American","name":"American"},{"slug":"AnimalRights","name":"AnimalRights"},{"slug":"Animals","name":"Animals"},{"slug":"Anime&Manga","name":"Anime&Manga"},{"slug":"Anniversary","name":"Anniversary"},{"slug":"Aquatic","name":"Aquatic"},{"slug":"Archaeology","name":"Archaeology"},{"slug":"Arts&Crafts","name":"Arts&Crafts"},{"slug":"Astronomy","name":"Astronomy"},{"slug":"Aunt","name":"Aunt"},{"slug":"Autism","name":"Autism"},{"slug":"Awareness&Beliefs","name":"Awareness&Beliefs"},{"slug":"Baby","name":"Baby"},{"slug":"BachelorParty","name":"BachelorParty"},{"slug":"BacheloretteParty","name":"BacheloretteParty"},{"slug":"BacktoSchool","name":"BacktoSchool"},{"slug":"Baseball","name":"Baseball"},{"slug":"Basketball","name":"Basketball"},{"slug":"BassGuitar","name":"BassGuitar"},{"slug":"Beach","name":"Beach"},{"slug":"Bele","name":"Bele"},{"slug":"Beer","name":"Beer"},{"slug":"Bestfriend","name":"Bestfriend"},{"slug":"Birds","name":"Birds"},{"slug":"Birthday","name":"Birthday"},{"slug":"BlackLivesMatter","name":"BlackLivesMatter"},{"slug":"Bohemian","name":"Bohemian"},{"slug":"Books","name":"Books"},{"slug":"Boyfriend","name":"Boyfriend"},{"slug":"Bulldog","name":"Bulldog"},{"slug":"Camping","name":"Camping"},{"slug":"Cancer","name":"Cancer"},{"slug":"Cannabis","name":"Cannabis"},{"slug":"Car","name":"Car"},{"slug":"Cartoons","name":"Cartoons"},{"slug":"Cats","name":"Cats"},{"slug":"Causes","name":"Causes"},{"slug":"Celebrations","name":"Celebrations"},{"slug":"Chihuahua","name":"Chihuahua"},{"slug":"Children","name":"Children"},{"slug":"ChineseNewYear","name":"ChineseNewYear"},{"slug":"ChristianHolidays","name":"ChristianHolidays"},{"slug":"Christmas","name":"Christmas"},{"slug":"CincodeMayo","name":"CincodeMayo"},{"slug":"Coffee","name":"Coffee"},{"slug":"Comedy","name":"Comedy"},{"slug":"Corgi","name":"Corgi"},{"slug":"Cosplay","name":"Cosplay"},{"slug":"Country","name":"Country"},{"slug":"Dachshund&WienerDog","name":"Dachshund&WienerDog"},{"slug":"DadJokes","name":"DadJokes"},{"slug":"Daughter","name":"Daughter"},{"slug":"Decades","name":"Decades"},{"slug":"Democrat","name":"Democrat"},{"slug":"Dinosaurs","name":"Dinosaurs"},{"slug":"Discrimination","name":"Discrimination"},{"slug":"Diversity","name":"Diversity"},{"slug":"DogBreeds","name":"DogBreeds"},{"slug":"Dogs","name":"Dogs"},{"slug":"Drama","name":"Drama"},{"slug":"Drummer","name":"Drummer"},{"slug":"Easter","name":"Easter"},{"slug":"EDM","name":"EDM"},{"slug":"Education","name":"Education"},{"slug":"Emoji","name":"Emoji"},{"slug":"EqualRights","name":"EqualRights"},{"slug":"ExtendedFamily","name":"ExtendedFamily"},{"slug":"Extinct","name":"Extinct"},{"slug":"Fall&Autumn","name":"Fall&Autumn"},{"slug":"Family&Relationships","name":"Family&Relationships"},{"slug":"Farming&Nature","name":"Farming&Nature"},{"slug":"Fashion&Beauty","name":"Fashion&Beauty"},{"slug":"Father","name":"Father"},{"slug":"Father'sDay","name":"Father'sDay"},{"slug":"Feminism","name":"Feminism"},{"slug":"Film","name":"Film"},{"slug":"Fishing","name":"Fishing"},{"slug":"Fls","name":"Fls"},{"slug":"FlowerGarden","name":"FlowerGarden"},{"slug":"Food","name":"Food"},{"slug":"Football","name":"Football"},{"slug":"FourthofJuly","name":"FourthofJuly"},{"slug":"FrenchBulldog","name":"FrenchBulldog"},{"slug":"Friend","name":"Friend"},{"slug":"Gardening","name":"Gardening"},{"slug":"Geology","name":"Geology"},{"slug":"GermanShepherd","name":"GermanShepherd"},{"slug":"Girlfriend","name":"Girlfriend"},{"slug":"Golf","name":"Golf"},{"slug":"Grandparent","name":"Grandparent"},{"slug":"Guitar","name":"Guitar"},{"slug":"Gymnastics","name":"Gymnastics"},{"slug":"Halloween","name":"Halloween"},{"slug":"Hip-Hop","name":"Hip-Hop"},{"slug":"Hippie","name":"Hippie"},{"slug":"Hobbies","name":"Hobbies"},{"slug":"Hockey","name":"Hockey"},{"slug":"Holidays&Events","name":"Holidays&Events"},{"slug":"Horses","name":"Horses"},{"slug":"HumanRights","name":"HumanRights"},{"slug":"Humor","name":"Humor"},{"slug":"Hunting","name":"Hunting"},{"slug":"Husband","name":"Husband"},{"slug":"IndependenceDay","name":"IndependenceDay"},{"slug":"Insects&Bugs","name":"Insects&Bugs"},{"slug":"Instruments","name":"Instruments"},{"slug":"Jobs","name":"Jobs"},{"slug":"Jokes","name":"Jokes"},{"slug":"Kawaii","name":"Kawaii"},{"slug":"Kittens","name":"Kittens"},{"slug":"Lazy","name":"Lazy"},{"slug":"LGBTQRights","name":"LGBTQRights"},{"slug":"Lifestyle","name":"Lifestyle"},{"slug":"MardiGras","name":"MardiGras"},{"slug":"Marrie","name":"Marrie"},{"slug":"MartialArts","name":"MartialArts"},{"slug":"Medicine","name":"Medicine"},{"slug":"Memes","name":"Memes"},{"slug":"MemorialDay","name":"MemorialDay"},{"slug":"Mermaid","name":"Mermaid"},{"slug":"Military","name":"Military"},{"slug":"Moon","name":"Moon"},{"slug":"Mother","name":"Mother"},{"slug":"Mother'sDay","name":"Mother'sDay"},{"slug":"Motivational","name":"Motivational"},{"slug":"Motorcycle","name":"Motorcycle"},{"slug":"Movies&TV","name":"Movies&TV"},{"slug":"Music","name":"Music"},{"slug":"Musicican","name":"Musicican"},{"slug":"Muslim","name":"Muslim"},{"slug":"Mythical","name":"Mythical"},{"slug":"Nerd&Geek","name":"Nerd&Geek"},{"slug":"NewYear's","name":"NewYear's"},{"slug":"Nurse","name":"Nurse"},{"slug":"Outdoors","name":"Outdoors"},{"slug":"Parent","name":"Parent"},{"slug":"Party","name":"Party"},{"slug":"Pets","name":"Pets"},{"slug":"Pop","name":"Pop"},{"slug":"President","name":"President"},{"slug":"Pride","name":"Pride"},{"slug":"Pug","name":"Pug"},{"slug":"Puppies","name":"Puppies"},{"slug":"Quotes","name":"Quotes"},{"slug":"Racing","name":"Racing"},{"slug":"Ramadan","name":"Ramadan"},{"slug":"Relationship","name":"Relationship"},{"slug":"Religion","name":"Religion"},{"slug":"Reptiles","name":"Reptiles"},{"slug":"RescueDogs","name":"RescueDogs"},{"slug":"Rock'nRoll","name":"Rock'nRoll"},{"slug":"Running","name":"Running"},{"slug":"SaberToothedCats","name":"SaberToothedCats"},{"slug":"School","name":"School"},{"slug":"Sciences","name":"Sciences"},{"slug":"Singer","name":"Singer"},{"slug":"Skateboarding","name":"Skateboarding"},{"slug":"Sloths","name":"Sloths"},{"slug":"Soccer","name":"Soccer"},{"slug":"Son","name":"Son"},{"slug":"Sorority","name":"Sorority"},{"slug":"Space","name":"Space"},{"slug":"Sports","name":"Sports"},{"slug":"St.Patrick'sDay","name":"St.Patrick'sDay"},{"slug":"States","name":"States"},{"slug":"Summer","name":"Summer"},{"slug":"Surfing","name":"Surfing"},{"slug":"Swimming","name":"Swimming"},{"slug":"Tattoos","name":"Tattoos"},{"slug":"Teacher","name":"Teacher"},{"slug":"ThanksgivingDay","name":"ThanksgivingDay"},{"slug":"Treling","name":"Treling"},{"slug":"Unicorn","name":"Unicorn"},{"slug":"USHolidays","name":"USHolidays"},{"slug":"Valentine'sDay","name":"Valentine'sDay"},{"slug":"Vampire","name":"Vampire"},{"slug":"Vegan","name":"Vegan"},{"slug":"Veteran'sDay","name":"Veteran'sDay"},{"slug":"Veterans","name":"Veterans"},{"slug":"VideoGames","name":"VideoGames"},{"slug":"Volleyball","name":"Volleyball"},{"slug":"Wife","name":"Wife"},{"slug":"Women'sRights","name":"Women'sRights"},{"slug":"WorldPeace","name":"WorldPeace"},{"slug":"Yoga","name":"Yoga"},{"slug":"YogaInstructor","name":"YogaInstructor"},{"slug":"Zodiac-Aquarius","name":"Zodiac-Aquarius"},{"slug":"Zodiac-Aries","name":"Zodiac-Aries"},{"slug":"Zodiac-Cancer","name":"Zodiac-Cancer"},{"slug":"Zodiac-Capricorn","name":"Zodiac-Capricorn"},{"slug":"Zodiac-Gemini","name":"Zodiac-Gemini"},{"slug":"Zodiac-Leo","name":"Zodiac-Leo"},{"slug":"Zodiac-Libra","name":"Zodiac-Libra"},{"slug":"Zodiac-Pisces","name":"Zodiac-Pisces"},{"slug":"Zodiac-Sittarius","name":"Zodiac-Sittarius"},{"slug":"Zodiac-Scorpio","name":"Zodiac-Scorpio"},{"slug":"Zodiac-Taurus","name":"Zodiac-Taurus"},{"slug":"Zodiac-Virgo","name":"Zodiac-Virgo"}],"topTs":[{"imePrefix":"s3-us-west-2.amazonaws.com/scalable-licensing/public/assets/marketplace/Food.png","name":"Food","slug":"Food"},{"imePrefix":"s3-us-west-2.amazonaws.com/scalable-licensing/public/assets/marketplace/Arts+and+Crafts.png","name":"Arts&Crafts","slug":"Arts&Crafts"},{"imePrefix":"s3-us-west-2.amazonaws.com/scalable-licensing/public/assets/marketplace/Season.png","name":"Seasons","slug":"Seasons"},{"imePrefix":"s3-us-west-2.amazonaws.com/scalable-licensing/public/assets/marketplace/Holiday.png","name":"USHolidays","slug":"USHolidays"},{"imePrefix":"s3-us-west-2.amazonaws.com/scalable-licensing/public/assets/marketplace/Motivational.png","name":"Motivational","slug":"Motivational"},{"imePrefix":"s3-us-west-2.amazonaws.com/scalable-licensing/public/assets/marketplace/Education.png","name":"Education","slug":"Education"}],"tMap":[{"children":[{"slug":"Mythical","name":"Mythical"},{"slug":"Aquatic&Land","name":"Aquatic&Land"},{"slug":"Pets","name":"Pets"},{"slug":"Birds","name":"Birds"},{"slug":"Insects&Bugs","name":"Insects&Bugs"},{"slug":"Reptiles","name":"Reptiles"},{"slug":"Extinct","name":"Extinct"},{"slug":"LandAnimals","name":"LandAnimals"},{"slug":"DogBreeds","name":"DogBreeds"},{"slug":"Aquatic","name":"Aquatic"},{"slug":"FarmAnimals","name":"FarmAnimals"}],"slug":"Animals","name":"Animals","imePrefix":"s3-us-west-2.amazonaws.com/scalable-licensing/public/assets/marketplace/Animals.png"},{"children":[{"slug":"Games","name":"Games"},{"slug":"VideoGames","name":"VideoGames"},{"slug":"Arts&Crafts","name":"Arts&Crafts"},{"slug":"Outdoors","name":"Outdoors"},{"slug":"Fishing","name":"Fishing"},{"slug":"ModelBuilding","name":"ModelBuilding"},{"slug":"Cooking","name":"Cooking"},{"slug":"Hunting","name":"Hunting"},{"slug":"Instruments","name":"Instruments"},{"slug":"Aquarium","name":"Aquarium"},{"slug":"Gardening","name":"Gardening"},{"slug":"Collecting","name":"Collecting"},{"slug":"Computer","name":"Computer"},{"slug":"Flying","name":"Flying"}],"slug":"Hobbies","name":"Hobbies","imePrefix":"s3-us-west-2.amazonaws.com/scalable-licensing/public/assets/marketplace/Hobbies.png"},{"children":[{"slug":"Celebrities","name":"Celebrities"},{"slug":"Music","name":"Music"},{"slug":"Books","name":"Books"},{"slug":"Movies&TV","name":"Movies&TV"},{"slug":"Anime&Manga","name":"Anime&Manga"},{"slug":"Dance","name":"Dance"},{"slug":"Mic","name":"Mic"},{"slug":"Theatre","name":"Theatre"},{"slug":"Radio","name":"Radio"},{"slug":"Circus","name":"Circus"},{"slug":"Humor","name":"Humor"}],"slug":"Entertainment","name":"Entertainment","imePrefix":"s3-us-west-2.amazonaws.com/scalable-licensing/public/assets/marketplace/Entertainment.png"},{"children":[{"slug":"States","name":"States"},{"slug":"Country","name":"Country"},{"slug":"Continent","name":"Continent"},{"slug":"InternationalCities","name":"InternationalCities"},{"slug":"AtoZCity","name":"AtoZCity"}],"slug":"Places","name":"Places","imePrefix":"s3-us-west-2.amazonaws.com/scalable-licensing/public/assets/marketplace/Places.png"},{"children":[{"slug":"Legal","name":"Legal"},{"slug":"Military","name":"Military"},{"slug":"Farming&Nature","name":"Farming&Nature"},{"slug":"Film","name":"Film"},{"slug":"Fashion&Beauty","name":"Fashion&Beauty"},{"slug":"Engineers","name":"Engineers"},{"slug":"SocialWorker","name":"SocialWorker"},{"slug":"Electricity","name":"Electricity"},{"slug":"Transportation","name":"Transportation"},{"slug":"Metalworking","name":"Metalworking"},{"slug":"NotWorking","name":"NotWorking"},{"slug":"Accounting&Finance","name":"Accounting&Finance"},{"slug":"LawEnforcement","name":"LawEnforcement"},{"slug":"Maintenance","name":"Maintenance"},{"slug":"InventoryManement","name":"InventoryManement"},{"slug":"Oil&Mining","name":"Oil&Mining"},{"slug":"OfficeManement","name":"OfficeManement"},{"slug":"Medicine","name":"Medicine"},{"slug":"Educator","name":"Educator"},{"slug":"Musicican","name":"Musicican"},{"slug":"Scientist","name":"Scientist"},{"slug":"HR&Recruiting","name":"HR&Recruiting"},{"slug":"Sports&Fitness","name":"Sports&Fitness"},{"slug":"Marketing&Communications","name":"Marketing&Communications"},{"slug":"Design","name":"Design"},{"slug":"Construction","name":"Construction"},{"slug":"CulinaryArts","name":"CulinaryArts"},{"slug":"Media&Journalism","name":"Media&Journalism"},{"slug":"Executive","name":"Executive"},{"slug":"Technology","name":"Technology"}],"slug":"Jobs","name":"Jobs","imePrefix":"s3-us-west-2.amazonaws.com/scalable-licensing/public/assets/marketplace/Jobs.png"},{"children":[{"slug":"Friend","name":"Friend"},{"slug":"Grandparent","name":"Grandparent"},{"slug":"Parent","name":"Parent"},{"slug":"Grandchild","name":"Grandchild"},{"slug":"Relationship","name":"Relationship"},{"slug":"In-Laws","name":"In-Laws"},{"slug":"Children","name":"Children"},{"slug":"Sibling","name":"Sibling"},{"slug":"EthnicGroups","name":"EthnicGroups"},{"slug":"ExtendedFamily","name":"ExtendedFamily"}],"slug":"Family&Relationships","name":"Family&Relationships","imePrefix":"s3-us-west-2.amazonaws.com/scalable-licensing/public/assets/marketplace/Family+and+Relationships.png"}]},"createdAt":"2017-07-26T05:30:37.140Z","scope":{"groupId":"587d0d41cee36fd012c64a69","type":"landing-data"},"__v":0}}}},"aliases":{"id":"_id"},"listeners":[],"customResults":{"landingData":{"{\"groupId\":\"587d0d41cee36fd012c64a69\"}":{"alias":"id","result":"fd4b238a623b39c669","fetchedAt":"2024-07-16T05:30:51.385Z"}}},"methods":{},"custom":{"topStorefronts":{},"nigationT":{},"landingData":{},"shopProducts":{}},"cachable":true},"UpsellData":{"name":"UpsellData","docs":{},"aliases":{},"listeners":[],"customResults":{},"methods":{},"custom":{"byRetailOrderId":{},"mugUpsell":{},"productUpsell":{},"campaignProductUpsell":{}},"cachable":false},"CashReward":{"name":"CashReward","docs":{},"aliases":{"id":"id"},"listeners":[],"customResults":{},"methods":{},"custom":{"ailable":{},"rewardDetails":{}},"cachable":true},"CategoryMap":{"name":"CategoryMap","docs":{},"aliases":{"id":"_id"},"listeners":[],"customResults":{},"methods":{},"custom":{},"cachable":true},"Retailer":{"name":"Retailer","docs":{},"aliases":{},"listeners":[],"customResults":{},"methods":{},"custom":{"path":{}},"cachable":false},"Setting":{"name":"Setting","docs":{},"aliases":{"name":"name"},"listeners":[],"customResults":{},"methods":{},"custom":{"pesMeta":{}},"cachable":true},"Depend":{"name":"Depend","docs":{},"aliases":{},"listeners":[],"customResults":{},"methods":{},"custom":{},"cachable":false}},"XSRF":{"token":"sKNaQwE0-A4klj-AtirYelaE9zzSQBoP2ebY"},"botServer":false,"userent":{"isMobile":false,"isTablet":false,"isDesktop":true,"isBot":false},"productCategoryMap":{"_id":"PRODUCT_CATEGORY_MAP","categoryDisplayMap":{"jewelry":"Jewelry","jewelry.bracelets":"Bracelets","bracelets":"Bracelets","jewelry.bracelets.metallic-circle-bracelet":"MetallicCircleBracelet","metallic-circle-bracelet":"MetallicCircleBracelet","jewelry.bracelets.cord-circle-bracelet":"CordCircleBracelet","cord-circle-bracelet":"CordCircleBracelet","jewelry.earrings":"Earrings","earrings":"Earrings","jewelry.earrings.teardrop-earrings":"TeardropEarrings","teardrop-earrings":"TeardropEarrings","jewelry.earrings.circle-earrings":"CircleEarrings","circle-earrings":"CircleEarrings","jewelry.necklaces":"Necklaces","necklaces":"Necklaces","jewelry.necklaces.metallic-necklace":"MetallicNecklaces","metallic-necklace":"MetallicNecklaces","jewelry.necklaces.metallic-necklace.metallic-rectangle-necklace":"MetallicRectangleNecklace","metallic-rectangle-necklace":"MetallicRectangleNecklace","jewelry.necklaces.metallic-necklace.metallic-heart-necklace":"MetallicHeartNecklace","metallic-heart-necklace":"MetallicHeartNecklace","jewelry.necklaces.metallic-necklace.metallic-circle-necklace":"MetallicCircleNecklace","metallic-circle-necklace":"MetallicCircleNecklace","jewelry.necklaces.cord-necklace":"CordNecklaces","cord-necklace":"CordNecklaces","jewelry.necklaces.cord-necklace.cord-rectangle-necklace":"CordRectangleNecklace","cord-rectangle-necklace":"CordRectangleNecklace","jewelry.necklaces.cord-necklace.cord-heart-necklace":"CordHeartNecklace","cord-heart-necklace":"CordHeartNecklace","jewelry.necklaces.cord-necklace.cord-circle-necklace":"CordCircleNecklace","cord-circle-necklace":"CordCircleNecklace","accessories":"Accessories","accessories.car":"Car","car":"Car","accessories.car.car-seat-cover":"CarSeatCovers","car-seat-cover":"CarSeatCovers","accessories.car.car-seat-organizer":"CarSeatOrganizer","car-seat-organizer":"CarSeatOrganizer","accessories.wallets":"Wallets","wallets":"Wallets","accessories.wallets.women-wallet":"Women'sWallet","women-wallet":"Women'sWallet","accessories.wallets.women-leather-wallet-vertical":"Women'sLeatherWallet(vertical)","women-leather-wallet-vertical":"Women'sLeatherWallet(vertical)","accessories.wallets.men-leather-wallet":"Men'sLeatherWallet","men-leather-wallet":"Men'sLeatherWallet","accessories.wallets.mini-wallet":"MiniWallet","mini-wallet":"MiniWallet","accessories.wallets.women-leather-wallet-horizontal":"Women'sLeatherWallet(horizontal)","women-leather-wallet-horizontal":"Women'sLeatherWallet(horizontal)","accessories.scarves":"Scarves","scarves":"Scarves","accessories.scarves.fleece-scarf":"FleeceScarf","fleece-scarf":"FleeceScarf","accessories.yoga-mat":"YogaMat","yoga-mat":"YogaMat","accessories.yoga-mat.24x70":"YogaMat24x70(vertical)","24x70":"YogaMat24x70(vertical)","accessories.yoga-mat.70x24":"YogaMat70x24(horizontal)","70x24":"YogaMat70x24(horizontal)","accessories.neck-gaiter":"NeckGaiter","neck-gaiter":"NeckGaiter","accessories.masks":"Masks","masks":"Masks","accessories.masks.3-layer-kids":"3LayerKidsFaceMask","3-layer-kids":"3LayerKidsFaceMask","accessories.masks.3-layer":"3LayerFaceMask","3-layer":"3LayerFaceMask","accessories.masks.face-mask":"ClothFaceMask","face-mask":"ClothFaceMask","accessories.masks.2-layer":"2LayerFaceMask","2-layer":"2LayerFaceMask","accessories.masks.2-layer-kids":"2LayerKidsFaceMask","2-layer-kids":"2LayerKidsFaceMask","accessories.ties":"Ties","ties":"Ties","accessories.ties.tie":"Ties","tie":"Ties","accessories.mousepads":"Mousepads","mousepads":"Mousepads","accessories.mousepads.mousepad":"Mousepads","mousepad":"Mousepads","accessories.hats":"Hats","hats":"Hats","accessories.hats.knit-beanie":"KnitBeanie","knit-beanie":"KnitBeanie","accessories.hats.embroidered-hat":"EmbroideredHat","embroidered-hat":"EmbroideredHat","accessories.hats.trucker-hat":"TruckerHats","trucker-hat":"TruckerHats","accessories.hats.classic-hat":"ClassicHats","classic-hat":"ClassiTeeChip ‘Jos124; Loja de impressões personalizadas ‘Josep 124; camisetas, canecas, máscaras faciais, cartazes’cHats","accessories.bs":"Bs","bs":"Bs","accessories.bs.weekender-tote":"WeekenderTote","weekender-tote":"WeekenderTote","accessories.bs.weekender-tote.24x13-rope-handle":"24x13”RopeHandle","24x13-rope-handle":"24x13”RopeHandle","accessories.bs.accessory-pouches":"AccessoryPouches","accessory-pouches":"AccessoryPouches","accessories.bs.accessory-pouches.8x6":"8-5x6”BlackZipper","8x6":"8-5x6”BlackZipper","accessories.bs.accessory-pouches.8x6.8-5x6-black-zipper":"8.5x6”BlackZipper","8-5x6-black-zipper":"8.5x6”BlackZipper","accessories.bs.accessory-pouches.12x5":"12-5x8-5”BlackZipper","12x5":"12-5x8-5”BlackZipper","accessories.bs.accessory-pouches.12x5.12-5x8-5-black-zipper":"12-5x8-5”BlackZipper","12-5x8-5-black-zipper":"12-5x8-5”BlackZipper","accessories.bs.sling-pack":"SlingPack","sling-pack":"SlingPack","accessories.bs.backpack":"Backpack","backpack":"Backpack","accessories.bs.tote":"ToteBs","tote":"ToteBs","accessories.bs.tote.16x16-all-over-totes":"16x16”AlloverTotes","16x16-all-over-totes":"16x16”AlloverTotes","accessories.bs.tote.tote-b":"Totebs","tote-b":"Totebs","accessories.bs.drawstring":"DrawstringBs","drawstring":"DrawstringBs","accessories.bs.drawstring.drawstring-b":"Drawstringbs","drawstring-b":"Drawstringbs","accessories.phonecases":"PhoneCases","phonecases":"PhoneCases","accessories.phonecases.case":"Phonecases","case":"Phonecases","accessories.stickers":"Stickers","stickers":"Stickers","accessories.stickers.stickers":"Stickers","accessories.stickers.bumper-sticker":"BumperSticker","bumper-sticker":"BumperSticker","accessories.notebooks":"Notebooks","notebooks":"Notebooks","accessories.notebooks.leather-notebook-b5":"Large","leather-notebook-b5":"Large","accessories.notebooks.leather-notebook-a5":"Medium","leather-notebook-a5":"Medium","accessories.purse":"Purse","purse":"Purse","accessories.purse.women-clutch-purse-horizontal":"Women'sClutchPurse(horizontal)","women-clutch-purse-horizontal":"Women'sClutchPurse(horizontal)","accessories.purse.women-clutch-purse-vertical":"Women'sClutchPurse(vertical)","women-clutch-purse-vertical":"Women'sClutchPurse(vertical)","accessories.lugge-covers":"LuggeCovers","lugge-covers":"LuggeCovers","accessories.lugge-covers.large":"Large","large":"Large","accessories.lugge-covers.small":"Small","small":"Small","accessories.lugge-covers.medium":"Medium","medium":"Medium","home-living":"Home&Living","home-living.laundry-baskets":"LaundryBaskets","laundry-baskets":"LaundryBaskets","home-living.laundry-baskets.laundry-basket":"LaundryBasket","laundry-basket":"LaundryBasket","home-living.doormats":"Doormats","doormats":"Doormats","home-living.doormats.doormat-28-x-17":"Doormat28\"x17\"","doormat-28-x-17":"Doormat28\"x17\"","home-living.doormats.doormat-22-5x15":"Doormat22.5\"x15\"","doormat-22-5x15":"Doormat22.5\"x15\"","home-living.doormats.doormat-34-x-23":"Doormat34\"x23\"","doormat-34-x-23":"Doormat34\"x23\"","home-living.christmas-stocking":"ChristmasStockings","christmas-stocking":"ChristmasStocking","home-living.christmas-stocking.christmas-stocking":"ChristmasStocking","home-living.yard-signs":"YardSigns","yard-signs":"YardSigns","home-living.yard-signs.24x18":"24x18\"","24x18":"24x18\"","home-living.yard-signs.18x12":"18x12\"","18x12":"18x12\"","home-living.pet-beds":"PetBeds","pet-beds":"PetBeds","home-living.pet-beds.50x40":"50x40”PetBeds","50x40":"50x40”PetBeds","home-living.pet-beds.50x40.50x40-pet-beds":"50x40”PetBeds","50x40-pet-beds":"50x40”PetBeds","home-living.pet-beds.40x30":"40x30”PetBeds","40x30":"40x30”PetBeds","home-living.pet-beds.40x30.40x30-pet-beds":"40x30”PetBeds","40x30-pet-beds":"40x30”PetBeds","home-living.pet-beds.28x18":"28x18”PetBeds","28x18":"28x18”PetBeds","home-living.pet-beds.28x18.28x18-pet-beds":"28x18”PetBeds","28x18-pet-beds":"28x18”PetBeds","home-living.cutting-boards":"CuttingBoards","cutting-boards":"CuttingBoards","home-living.cutting-boards.cutting-board":"CuttingBoards","cutting-board":"CuttingBoards","home-living.coasters":"Coasters","coasters":"Coasters","home-living.coasters.square-coaster":"Squarecoasters","square-coaster":"Squarecoasters","home-living.coasters.circle-coaster":"Circlecoasters","circle-coaster":"Circlecoasters","home-living.mnets":"Mnets","mnets":"Mnets","home-living.mnets.square-mnet":"Squaremnets","square-mnet":"Squaremnets","home-living.mnets.circle-mnet":"Circlemnets","circle-mnet":"Circlemnets","home-living.bath-and-towels":"Bath&Towels","bath-and-towels":"Bath&Towels","home-living.bath-and-towels.tea-towels":"TeaTowels","tea-towels":"TeaTowels","home-living.bath-and-towels.tea-towels.18x30-tea-towels":"18x30”TeaTowels","18x30-tea-towels":"18x30”TeaTowels","home-living.bath-and-towels.beach-towels":"BeachTowels","beach-towels":"BeachTowels","home-living.bath-and-towels.beach-towels.36x72-beach-towel-microfiber":"36x72”BeachTowel-Microfiber","36x72-beach-towel-microfiber":"36x72”BeachTowel-Microfiber","home-living.bath-and-towels.beach-towels.beach-towel":"Beachtowels","beach-towel":"Beachtowels","home-living.bath-and-towels.hand-towel":"Handtowels","hand-towel":"Handtowels","home-living.bath-and-towels.bath-towels":"BathTowels","bath-towels":"BathTowels","home-living.bath-and-towels.bath-towels.30x60-bath-towel-microfiber":"30x60”BathTowel-Microfiber","30x60-bath-towel-microfiber":"30x60”BathTowel-Microfiber","home-living.bath-and-towels.bath-mats":"BathMats","bath-mats":"BathMats","home-living.bath-and-towels.bath-mats.34x21-bath-mats":"34x21”BathMats","34x21-bath-mats":"34x21”BathMats","home-living.bath-and-towels.bath-mats.24x17-bath-mats":"24x17”BathMats","24x17-bath-mats":"24x17”BathMats","home-living.bath-and-towels.shower-curtains":"ShowerCurtains","shower-curtains":"ShowerCurtains","home-living.bath-and-towels.shower-curtains.71x74-shower-curtain":"71x74”ShowerCurtain","71x74-shower-curtain":"71x74”ShowerCurtain","home-living.kitchen-and-dining":"Kitchen&Dining","kitchen-and-dining":"Kitchen&Dining","home-living.kitchen-and-dining.runners":"Runners","runners":"Runners","home-living.kitchen-and-dining.runners.16x90":"16x90”Runners","16x90":"16x90”Runners","home-living.kitchen-and-dining.runners.16x90.16x90-runners":"16x90”Runners","16x90-runners":"16x90”Runners","home-living.kitchen-and-dining.runners.16x72":"16x72”Runners","16x72":"16x72”Runners","home-living.kitchen-and-dining.runners.16x72.16x72-runners":"16x72”Runners","16x72-runners":"16x72”Runners","home-living.kitchen-and-dining.woven-rugs":"WovenRugs","woven-rugs":"WovenRugs","home-living.kitchen-and-dining.woven-rugs.6x4":"6x4”Rugs(dobby)","6x4":"6x4","home-living.kitchen-and-dining.woven-rugs.6x4.6x4-rugs-dobby":"6x4”Rugs(dobby)","6x4-rugs-dobby":"6x4”Rugs(dobby)","home-living.kitchen-and-dining.woven-rugs.3x2":"3x2”Rugs(dobby)","3x2":"3x2","home-living.kitchen-and-dining.woven-rugs.3x2.3x2-rugs-dobby":"3x2”Rugs(dobby)","3x2-rugs-dobby":"3x2”Rugs(dobby)","home-living.kitchen-and-dining.aprons":"Aprons","aprons":"Aprons","home-living.kitchen-and-dining.aprons.27x30-apron":"27x30”Apron","27x30-apron":"27x30”Apron","home-living.kitchen-and-dining.placemats":"Placemats","placemats":"Placemats","home-living.kitchen-and-dining.placemats.18x14-placemats":"18x14”Placemats","18x14-placemats":"18x14”Placemats","home-living.pillows-and-bedding":"Pillows&Bedding","pillows-and-bedding":"Pillows&Bedding","home-living.pillows-and-bedding.hooded-blankets":"HoodedBlankets","hooded-blankets":"HoodedBlankets","home-living.pillows-and-bedding.hooded-blankets.l":"HoodedBlanketL","l":"Men'sAOPT-ShirtLarge","home-living.pillows-and-bedding.hooded-blankets.s":"HoodedBlanketS","s":"Women'sAOPT-ShirtS","home-living.pillows-and-bedding.hooded-blankets.m":"HoodedBlanketM","m":"Men'sAOPT-ShirtMedium","home-living.pillows-and-bedding.quilts":"Quilts","quilts":"Quilts","home-living.pillows-and-bedding.quilts.quilt":"Quilts","quilt":"Quilts","home-living.pillows-and-bedding.pillowcases":"Pillowcases","pillowcases":"Pillowcases","home-living.pillows-and-bedding.pillowcases.square-pillowcase":"Squarepillowcase","square-pillowcase":"Squarepillowcase","home-living.pillows-and-bedding.pillowcases.rectangular-pillowcase":"Rectangularpillowcase","rectangular-pillowcase":"Rectangularpillowcase","home-living.pillows-and-bedding.pillow-shams":"PillowShams","pillow-shams":"PillowShams","home-living.pillows-and-bedding.pillow-shams.38x22":"38x22”PillowShams-Microfiber-KingSize","38x22":"38x22”PillowShams-Microfiber-KingSize","home-living.pillows-and-bedding.pillow-shams.38x22.38x22-pillow-shams-microfiber-king":"38x22”PillowShams-Microfiber-KingSize","38x22-pillow-shams-microfiber-king":"38x22”PillowShams-Microfiber-KingSize","home-living.pillows-and-bedding.pillow-shams.30x22":"30x22”PillowShams-Microfiber-StandardSize","30x22":"30x22”PillowShams-Microfiber-StandardSize","home-living.pillows-and-bedding.pillow-shams.30x22.30x22-pillow-shams-microfiber-standard":"30x22”PillowShams-Microfiber-StandardSize","30x22-pillow-shams-microfiber-standard":"30x22”PillowShams-Microfiber-StandardSize","home-living.pillows-and-bedding.fleece-blankets":"FleeceBlankets","fleece-blankets":"FleeceBlankets","home-living.pillows-and-bedding.fleece-blankets.50x60":"50x60”FleeceBlankets-Sherpa","50x60":"50x60Wovenblankets","home-living.pillows-and-bedding.fleece-blankets.50x60.50x60-fleece-blankets-sherpa":"50x60”FleeceBlankets-Sherpa","50x60-fleece-blankets-sherpa":"50x60”FleeceBlankets-Sherpa","home-living.pillows-and-bedding.fleece-blankets.60x80":"60x80”FleeceBlankets","60x80":"60x80Wovenblankets","home-living.pillows-and-bedding.fleece-blankets.60x80.60x80-fleece-blankets-sherpa":"60x80”FleeceBlankets-Sherpa","60x80-fleece-blankets-sherpa":"60x80”FleeceBlankets-Sherpa","home-living.pillows-and-bedding.fleece-blankets.60x80.60x80-fleece-blankets-coral":"60x80”FleeceBlankets-Coral/Velveteen","60x80-fleece-blankets-coral":"60x80”FleeceBlankets-Coral/Velveteen","home-living.pillows-and-bedding.fleece-blankets.30x40":"30x40”FleeceBlankets-Coral/Velveteen","30x40":"30x40”FleeceBlankets-Coral/Velveteen","home-living.pillows-and-bedding.fleece-blankets.30x40.30x40-fleece-blankets-coral":"30x40”FleeceBlankets-Coral/Velveteen","30x40-fleece-blankets-coral":"30x40”FleeceBlankets-Coral/Velveteen","home-living.pillows-and-bedding.comforters":"Comforters","comforters":"Comforters","home-living.pillows-and-bedding.comforters.68x88":"68x88”Comforters-TwinSize","68x88":"68x88”DuvetCovers-Microfiber","home-living.pillows-and-bedding.comforters.68x88.68x88-comforters-twin":"68x88”Comforters-TwinSize","68x88-comforters-twin":"68x88”Comforters-TwinSize","home-living.pillows-and-bedding.comforters.68x92":"68x92”Comforters-TwinXLSize","68x92":"68x92”DuvetCovers-Microfiber","home-living.pillows-and-bedding.comforters.68x92.68x92-comforters-twin-xl":"68x92”Comforters-TwinXLSize","68x92-comforters-twin-xl":"68x92”Comforters-TwinXLSize","home-living.pillows-and-bedding.comforters.88x88":"88x88”Comforters-QueenSize","88x88":"88x88”DuvetCovers-Microfiber","home-living.pillows-and-bedding.comforters.88x88.88x88-comforters-queen":"88x88”Comforters-QueenSize","88x88-comforters-queen":"88x88”Comforters-QueenSize","home-living.pillows-and-bedding.comforters.104x88":"104x88”Comforters-KingSize","104x88":"104x88”DuvetCovers-Microfiber","home-living.pillows-and-bedding.comforters.104x88.104x88-comforters-king":"104x88”Comforters-KingSize","104x88-comforters-king":"104x88”Comforters-KingSize","home-living.pillows-and-bedding.duvet-covers":"DuvetCovers","duvet-covers":"DuvetCovers","home-living.pillows-and-bedding.duvet-covers.68x88":"68x88”DuvetCovers-Microfiber","home-living.pillows-and-bedding.duvet-covers.68x88.68x88-duvet-covers-microfiber":"68x88”DuvetCovers-Microfiber","68x88-duvet-covers-microfiber":"68x88”DuvetCovers-Microfiber","home-living.pillows-and-bedding.duvet-covers.68x92":"68x92”DuvetCovers-Microfiber","home-living.pillows-and-bedding.duvet-covers.68x92.68x92-duvet-covers-microfiber":"68x92”DuvetCovers-Microfiber","68x92-duvet-covers-microfiber":"68x92”DuvetCovers-Microfiber","home-living.pillows-and-bedding.duvet-covers.88x88":"88x88”DuvetCovers-Microfiber","home-living.pillows-and-bedding.duvet-covers.88x88.88x88-duvet-covers-microfiber":"88x88”DuvetCovers-Microfiber","88x88-duvet-covers-microfiber":"88x88”DuvetCovers-Microfiber","home-living.pillows-and-bedding.duvet-covers.104x88":"104x88”DuvetCovers-Microfiber","home-living.pillows-and-bedding.duvet-covers.104x88.104x88-duvet-covers-microfiber":"104x88”DuvetCovers-Microfiber","104x88-duvet-covers-microfiber":"104x88”DuvetCovers-Microfiber","home-living.pillows-and-bedding.decorative-pillows":"DecorativePillows","decorative-pillows":"DecorativePillows","home-living.pillows-and-bedding.decorative-pillows.18x18":"18x18”Pillow-SpunPolyester","18x18":"18x18”Pillow-SpunPolyester","home-living.pillows-and-bedding.decorative-pillows.18x18.18x18-pillow-spun-polyester":"18x18”Pillow-SpunPolyester","18x18-pillow-spun-polyester":"18x18”Pillow-SpunPolyester","home-living.pillows-and-bedding.decorative-pillows.16x16":"16x16”Pillow-SpunPolyester","16x16":"16x16'","home-living.pillows-and-bedding.decorative-pillows.16x16.16x16-pillow-spun-polyester":"16x16”Pillow-SpunPolyester","16x16-pillow-spun-polyester":"16x16”Pillow-SpunPolyester","home-living.pillows-and-bedding.quilt-bed-sets":"QuiltBedSets","quilt-bed-sets":"QuiltBedSets","home-living.pillows-and-bedding.quilt-bed-sets.queen":"Queen","queen":"Queen","home-living.pillows-and-bedding.quilt-bed-sets.twin":"Twin","twin":"Twin","home-living.pillows-and-bedding.quilt-bed-sets.king":"King","king":"King","home-living.pillows-and-bedding.sleeve-blankets":"SleeveBlankets","sleeve-blankets":"SleeveBlanket","home-living.pillows-and-bedding.sleeve-blankets.sleeve-blankets":"SleeveBlanket","home-living.pillows-and-bedding.woven-blankets":"WovenBlankets","woven-blankets":"WovenBlankets","home-living.pillows-and-bedding.woven-blankets.60x80":"60x80Wovenblankets","home-living.pillows-and-bedding.woven-blankets.50x60":"50x60Wovenblankets","home-living.wall-decoration":"WallDecoration","wall-decoration":"WallDecoration","home-living.wall-decoration.easel-back-canvas-print":"Easel-BackGalleryWrappedCanvas","easel-back-canvas-print":"Easel-BackGalleryWrappedCanvas","home-living.wall-decoration.easel-back-canvas-print.10x8":"10x8'","10x8":"10x8'","home-living.wall-decoration.easel-back-canvas-print.8x10":"8x10'","8x10":"8x10'","home-living.wall-decoration.hanging-canvas-print":"HangingCanvas","hanging-canvas-print":"HangingCanvas","home-living.wall-decoration.hanging-canvas-print.16x20":"16x20'","16x20":"16x20'","home-living.wall-decoration.hanging-canvas-print.12x16":"12x16'","12x16":"12x16'","home-living.wall-decoration.black-floating-framed-canvas-wrap-print":"FloatingFramedCanvasPrintsBlack","black-floating-framed-canvas-wrap-print":"FloatingFramedCanvasPrintsBlack","home-living.wall-decoration.black-floating-framed-canvas-wrap-print.14x11":"14x11'","14x11":"14x11'","home-living.wall-decoration.black-floating-framed-canvas-wrap-print.11x14":"11x14'","11x14":"11x14'","home-living.wall-decoration.white-floating-framed-canvas-wrap-print":"FloatingFramedCanvasPrintsWhite","white-floating-framed-canvas-wrap-print":"FloatingFramedCanvasPrintsWhite","home-living.wall-decoration.white-floating-framed-canvas-wrap-print.14x11":"14x11'","home-living.wall-decoration.white-floating-framed-canvas-wrap-print.11x14":"11x14'","home-living.wall-decoration.canvas-wrap-print":"GalleryWrappedCanvasPrints","canvas-wrap-print":"GalleryWrappedCanvasPrints","home-living.wall-decoration.canvas-wrap-print.16x16":"16x16'","home-living.wall-decoration.canvas-wrap-print.20x16":"20x16'","20x16":"20x16'","home-living.wall-decoration.canvas-wrap-print.30x20":"30x20'","30x20":"30x20'","home-living.wall-decoration.canvas-wrap-print.20x30":"20x30'","20x30":"20x30'","home-living.wall-decoration.canvas-wrap-print.16x20":"16x20'","home-living.wall-decoration.canvas-wrap-print.14x11":"14x11'","home-living.wall-decoration.canvas-wrap-print.11x14":"11x14'","home-living.wall-decoration.canvas-wrap-print.16x24":"16x24'","16x24":"16x24'","home-living.wall-decoration.canvas-wrap-print.24x16":"24x16'","24x16":"24x16'","home-living.wall-decoration.canvas-wrap-print.\b20x24":"\b20x24'","\b20x24":"\b20x24'","home-living.wall-decoration.canvas-wrap-print.\b24x20":"\b24x20'","\b24x20":"\b24x20'","home-living.wall-decoration.canvas-wrap-print.\b24x36":"\b24x36'","\b24x36":"\b24x36'","home-living.wall-decoration.canvas-wrap-print.\b36x24":"\b36x24'","\b36x24":"\b36x24'","home-living.wall-decoration.window-curtains":"WindowCurtains","window-curtains":"WindowCurtains","home-living.wall-decoration.window-curtains.50x84-window-curtains-sheer":"50x84”SheerWindowCurtains","50x84-window-curtains-sheer":"50x84”SheerWindowCurtains","home-living.wall-decoration.window-curtains.50x84-window-curtains-blackout":"50x84”BlackoutWindowCurtains","50x84-window-curtains-blackout":"50x84”BlackoutWindowCurtains","home-living.wall-decoration.wall-tapestries":"WallTapestries","wall-tapestries":"WallTapestries","home-living.wall-decoration.wall-tapestries.68x80":"68x80”IndoorHemmed-Nogrommets","68x80":"68x80”IndoorHemmed-Nogrommets","home-living.wall-decoration.wall-tapestries.68x80.68x80-indoor-hemmed":"68x80”IndoorHemmed-Nogrommets","68x80-indoor-hemmed":"68x80”IndoorHemmed-Nogrommets","home-living.wall-decoration.wall-tapestries.51x60":"51x60”IndoorHemmed-Nogrommets","51x60":"51x60”IndoorHemmed-Nogrommets","home-living.wall-decoration.wall-tapestries.51x60.51x60-indoor-hemmed":"51x60”IndoorHemmed-Nogrommets","51x60-indoor-hemmed":"51x60”IndoorHemmed-Nogrommets","home-living.wall-decoration.wall-tapestries.26x36":"26x36”IndoorHemmed-Nogrommets","26x36":"26x36”IndoorHemmed-Nogrommets","home-living.wall-decoration.wall-tapestries.26x36.26x36-indoor-hemmed":"26x36”IndoorHemmed-Nogrommets","26x36-indoor-hemmed":"26x36”IndoorHemmed-Nogrommets","home-living.wall-decoration.posters":"Posters","posters":"Posters","home-living.wall-decoration.posters.36-24":"36x24'Posters","36-24":"36x24'Posters","home-living.wall-decoration.posters.36-24.36x24-poster":"36x24'Posters","36x24-poster":"36x24'Posters","home-living.wall-decoration.posters.24-16":"24x16'Posters","24-16":"24x16'Posters","home-living.wall-decoration.posters.24-16.24x16-poster":"24x16'Posters","24x16-poster":"24x16'Posters","home-living.wall-decoration.posters.17-11":"17x11'Posters","17-11":"17x11'Posters","home-living.wall-decoration.posters.17-11.17x11-poster":"17x11'Posters","17x11-poster":"17x11'Posters","home-living.wall-decoration.posters.24-36":"24x36'Posters","24-36":"24x36'Posters","home-living.wall-decoration.posters.24-36.24x36-poster":"24x36'Posters","24x36-poster":"24x36'Posters","home-living.wall-decoration.posters.16-24":"16x24'Posters","16-24":"16x24'Posters","home-living.wall-decoration.posters.16-24.16x24-poster":"16x24'Posters","16x24-poster":"16x24'Posters","home-living.wall-decoration.posters.11-17":"11x17'Posters","11-17":"11x17'Posters","home-living.wall-decoration.posters.11-17.11x17-poster":"11x17'Posters","11x17-poster":"11x17'Posters","home-living.wall-decoration.wooden-prints":"WoodenPrints","wooden-prints":"WoodenPrints","home-living.wall-decoration.wooden-prints.36x10-5":"36x10.5\"-WoodenPrint","36x10-5":"36x10.5\"-WoodenPrint","home-living.wall-decoration.wooden-prints.14x14":"14x14\"-WoodenPrint","14x14":"14x14\"-WoodenPrint","home-living.wall-decoration.wooden-prints.24x36":"24x36\"-WoodenPrint","24x36":"24x36\"-WoodenPrint","home-living.wall-decoration.wooden-prints.36x24":"36x24\"-WoodenPrint","36x24":"36x24\"-WoodenPrint","home-living.wall-decoration.wooden-prints.10-5x36":"10.5x36\"-WoodenPrint","10-5x36":"10.5x36\"-WoodenPrint","home-living.wall-decoration.wooden-prints.14x24":"14x24\"-WoodenPrint","14x24":"14x24\"-WoodenPrint","home-living.wall-decoration.wooden-prints.24x24":"24x24\"-WoodenPrint","24x24":"24x24\"-WoodenPrint","home-living.wall-decoration.wooden-prints.17-5x24":"17.5x24\"-WoodenPrint","17-5x24":"17.5x24\"-WoodenPrint","home-living.wall-decoration.wooden-prints.24x17-5":"24x17.5\"-WoodenPrint","24x17-5":"24x17.5\"-WoodenPrint","home-living.wall-decoration.wooden-prints.10-5x10-5":"10.5x10.5\"-WoodenPrint","10-5x10-5":"10.5x10.5\"-WoodenPrint","home-living.wall-decoration.wooden-prints.24x14":"24x14\"-WoodenPrint","24x14":"24x14\"-WoodenPrint","home-living.drinkware":"Drinkware","drinkware":"Drinkware","home-living.drinkware.tumbler":"Tumblers","tumbler":"Tumblers","home-living.drinkware.tumbler.cone-glitter-tumbler-20oz":"20ozConeGlitterTumbler","cone-glitter-tumbler-20oz":"20ozConeGlitterTumbler","home-living.drinkware.tumbler.glitter-tumbler-30oz":"30ozGlitterTumbler","glitter-tumbler-30oz":"30ozGlitterTumbler","home-living.drinkware.tumbler.wine-tumbler":"Wine","wine-tumbler":"Wine","home-living.drinkware.tumbler.20oz":"20oz","20oz":"20oz","home-living.drinkware.tumbler.30oz":"30oz","30oz":"30oz","home-living.drinkware.tumbler.cone-glitter-tumbler-30oz":"30ozConeGlitterTumbler","cone-glitter-tumbler-30oz":"30ozConeGlitterTumbler","home-living.drinkware.tumbler.glitter-tumbler-20oz":"20ozGlitterTumbler","glitter-tumbler-20oz":"20ozGlitterTumbler","home-living.drinkware.color-changing-mugs":"ColorChangingMugs","color-changing-mugs":"ColorChangingMugs","home-living.drinkware.color-changing-mugs.color-changing-mug":"ColorChangingMugs","color-changing-mug":"ColorChangingMugs","home-living.drinkware.mugs":"Mugs","mugs":"Mugs","home-living.drinkware.mugs.mug":"Mugs","mug":"Mugs","home-living.drinkware.pint-glass":"PintGlasses","pint-glass":"PintGlasses","home-living.drinkware.pint-glass.16oz":"16oz","16oz":"16oz","home-living.drinkware.bottle":"Bottle","bottle":"Bottle","home-living.drinkware.bottle.light-bottle":"LightUpWaterBottle","light-bottle":"LightUpWaterBottle","home-living.drinkware.bottle.contour-vacuum-bottle":"VacuumBottle","contour-vacuum-bottle":"VacuumBottle","home-living.puzzles":"Puzzles","puzzles":"Puzzles","home-living.fls":"Fls","fls":"Fls","home-living.fls.house-29-5x39-5":"Fl29.5\"x39.5\"","house-29-5x39-5":"Fl29.5\"x39.5\"","home-living.fls.garden-11-5x17-5":"Fl11.5\"x17.5\"","garden-11-5x17-5":"Fl11.5\"x17.5\"","home-living.ornaments":"Ornaments","ornaments":"Ornaments","home-living.ornaments.tree-ornament-porcelain":"TreeOrnament","tree-ornament-porcelain":"TreeOrnament","home-living.ornaments.snowflake-ornament-porcelain":"SnowflakeOrnament","snowflake-ornament-porcelain":"SnowflakeOrnament","home-living.ornaments.bell-ornament-porcelain":"BellOrnament","bell-ornament-porcelain":"BellOrnament","home-living.ornaments.heart-ornament-porcelain":"HeartOrnament(Porcelain)","heart-ornament-porcelain":"HeartOrnament(Porcelain)","home-living.ornaments.star-ornament-porcelain":"StarOrnament(Porcelain)","star-ornament-porcelain":"StarOrnament(Porcelain)","home-living.ornaments.circle-ornament-porcelain":"CircleOrnament(Porcelain)","circle-ornament-porcelain":"CircleOrnament(Porcelain)","home-living.ornaments.heart-ornament-wood":"HeartOrnament(Wood)","heart-ornament-wood":"HeartOrnament(Wood)","home-living.ornaments.star-ornament-wood":"StarOrnament(Wood)","star-ornament-wood":"StarOrnament(Wood)","home-living.ornaments.circle-ornament-wood":"CircleOrnament(Wood)","circle-ornament-wood":"CircleOrnament(Wood)","home-living.ornaments.oval-ornament-porcelain":"OvalOrnament","oval-ornament-porcelain":"OvalOrnament","home-living.clocks":"Clocks","clocks":"Clocks","home-living.clocks.wall-clock":"WallClock","wall-clock":"WallClock","home-living.area-rugs":"AreaRugs","area-rugs":"AreaRugs","home-living.area-rugs.18x30":"18x30","18x30":"18x30","home-living.area-rugs.9x12":"9x12","9x12":"9x12","home-living.area-rugs.4x6":"4x6","4x6":"4x6","home-living.area-rugs.2x3":"2x3","2x3":"2x3","home-living.area-rugs.3x2":"3x2","home-living.area-rugs.5-round":"5Round","5-round":"5Round","home-living.area-rugs.6x4":"6x4","home-living.area-rugs.12x9":"12x9","12x9":"12x9","home-living.area-rugs.30x18":"30x18","30x18":"30x18","home-living.folding-stool":"FoldingStool","folding-stool":"FoldingStool","home-living.folding-stool.folding-stool":"FoldingStool","youth":"Youth&Baby","youth.onesies":"Onesies","onesies":"Onesies","youth.onesies.onesie":"Onesie","onesie":"Onesie","youth.youth-shirts":"YouthT-Shirts","youth-shirts":"YouthT-Shirts","youth.youth-shirts.youth-shirt":"Youthshirts","youth-shirt":"Youthshirts","women":"Women","women.all-over-print-dresses":"AllOverPrintDresses","all-over-print-dresses":"AllOverPrintDresses","women.all-over-print-dresses.women-racerback-tank-dress-s":"Women'sRacerbackTankDressS","women-racerback-tank-dress-s":"Women'sRacerbackTankDressS","women.all-over-print-dresses.women-racerback-tank-dress-l":"Women'sRacerbackTankDressL","women-racerback-tank-dress-l":"Women'sRacerbackTankDressL","women.all-over-print-dresses.women-racerback-tank-dress-m":"Women'sRacerbackTankDressM","women-racerback-tank-dress-m":"Women'sRacerbackTankDressM","women.sweatpants":"Sweatpants","sweatpants":"Sweatpants","women.sweatpants.sweatpant":"UnisexSweatpants","sweatpant":"Sweatpants","women.footwear":"Footwear","footwear":"Footwear","women.footwear.shoes":"Women'sShoes","shoes":"Men'sShoes","women.footwear.shoes.flip-flops":"Women'sFlipFlops","flip-flops":"Men'sFlipFlops","women.footwear.shoes.women-low-top-shoes":"Women'sLowTopShoes","women-low-top-shoes":"Women'sLowTopShoes","women.footwear.shoes.women-high-top-shoes":"Women'sHighTopShoes","women-high-top-shoes":"Women'sHighTopShoes","women.footwear.socks":"Socks","socks":"Socks","women.footwear.socks.sock":"Socks","sock":"Socks","women.leggings":"Leggings","leggings":"Leggings","women.leggings.legging":"Leggings","legging":"Leggings","women.leggings.high-waist-leggings":"HighWaistLeggings","high-waist-leggings":"HighWaistLeggings","women.dresses":"Dresses","dresses":"Dresses","women.dresses.dress":"Dresses","dress":"Dresses","women.sweatshirts":"Sweatshirts","sweatshirts":"Sweatshirts","women.sweatshirts.sweatshirt":"Sweatshirts","sweatshirt":"Sweatshirts","women.hoodies":"Hoodies","hoodies":"Hoodies","women.hoodies.women-hoodie":"Women'sHoodies","women-hoodie":"Women'sHoodies","women.hoodies.hoodie":"Hoodies","hoodie":"Hoodies","women.long-sleeve":"LongSleeves","long-sleeve":"LongSleeves","women.long-sleeve.dress-shirt":"DressShirt","dress-shirt":"Dressshirt","women.long-sleeve.lightweight-jacket":"LightweightJacket","lightweight-jacket":"LightweightJacket","women.long-sleeve.baseball-tee":"Baseballtee","baseball-tee":"Baseballtee","women.long-sleeve.crewneck-shirt":"Women'sCrewneckShirt","crewneck-shirt":"Men'sCrewneckShirt","women.long-sleeve.crewneck-shirt.longsleeve":"Longsleeveshirt","longsleeve":"Longsleeveshirt","women.tank-tops":"TankTops","tank-tops":"TankTops","women.tank-tops.all-over-print-tanktop":"AllOverPrintTanks","all-over-print-tanktop":"AllOverPrintTanks","women.tank-tops.all-over-print-tanktop.s":"Women'sRacerbackTanktopS","women.tank-tops.all-over-print-tanktop.m":"Women'sRacerbackTanktopM","women.tank-tops.all-over-print-tanktop.l":"Women'sRacerbackTanktopL","women.tank-tops.all-over-printed-tank":"AllOverUnisexTanks","all-over-printed-tank":"AllOverUnisexTanks","women.tank-tops.all-over-printed-tank.all-over-tanktop":"Alloverunisextank","all-over-tanktop":"Alloverunisextank","women.tank-tops.unisex-tank":"UnisexTanks","unisex-tank":"UnisexTanks","women.tank-tops.unisex-tank.tanktop":"Unisextank","tanktop":"Unisextank","women.tank-tops.flowy-tank":"LadiesFlowyTanks","flowy-tank":"LadiesFlowyTanks","women.tank-tops.flowy-tank.women-tanktop":"Ladiesflowytank","women-tanktop":"Ladiesflowytank","women.t-shirts":"T-Shirts","t-shirts":"T-Shirts","women.t-shirts.all-over-print-shirts":"AllOverPrintShirts","all-over-print-shirts":"AllOverPrintShirts","women.t-shirts.all-over-print-shirts.l":"Women'sAOPT-ShirtL","women.t-shirts.all-over-print-shirts.s":"Women'sAOPT-ShirtS","women.t-shirts.all-over-print-shirts.m":"Women'sAOPT-ShirtM","women.t-shirts.classic-polo":"ClassicPolo","classic-polo":"ClassicPolo","women.t-shirts.all-over-printed-tee":"AllOverUnisexShirts","all-over-printed-tee":"AllOverUnisexShirts","women.t-shirts.all-over-printed-tee.aos-shirt":"Premiumfittedladiestee","aos-shirt":"AOSshirts","women.t-shirts.premium-fitted-tee":"PremiumFittedLadiesTees","premium-fitted-tee":"PremiumFittedLadiesTees","women.t-shirts.premium-fitted-tee.women-premium-fitted":"Premiumfittedladiestee","women-premium-fitted":"Premiumfittedladiestee","women.t-shirts.ladies-tee":"LadiesTees","ladies-tee":"LadiesTees","women.t-shirts.ladies-tee.women-shirt":"Ladiestee","women-shirt":"Ladiestee","women.underwear":"Underwear","underwear":"Underwear","women.underwear.lace-panties":"LacePanties","lace-panties":"LacePanties","women.underwear.briefs":"Briefs","briefs":"Briefs","men":"Men","men.footwear":"Footwear","men.footwear.shoes":"Men'sShoes","men.footwear.shoes.canvas-slip-ons":"CanvasSlipOns","canvas-slip-ons":"CanvasSlipOns","men.footwear.shoes.men-low-top-shoes":"Men'sLowTopShoes","men-low-top-shoes":"Men'sLowTopShoes","men.footwear.shoes.men-high-top-shoes":"Men'sHighTopShoes","men-high-top-shoes":"Men'sHighTopShoes","men.footwear.shoes.flip-flops":"Men'sFlipFlops","men.footwear.socks":"Socks","men.footwear.socks.sock":"Socks","men.sweatshirts":"Sweatshirts","men.sweatshirts.sweatshirt":"Sweatshirts","men.hoodies":"Hoodies","men.hoodies.men-hoodie":"Men'sHoodies","men-hoodie":"Men'sHoodies","men.hoodies.hoodie":"Hoodies","men.long-sleeve":"LongSleeves","men.long-sleeve.dress-shirt":"Dressshirt","men.long-sleeve.lightweight-jacket":"LightweightJacket","men.long-sleeve.baseball-tee":"Baseballtee","men.long-sleeve.crewneck-shirt":"Men'sCrewneckShirt","men.long-sleeve.crewneck-shirt.longsleeve":"Longsleeveshirt","men.tank-tops":"TankTops","men.tank-tops.all-over-printed-tank":"AllOverUnisexTanks","men.tank-tops.all-over-printed-tank.all-over-tanktop":"Alloverunisextank","men.tank-tops.unisex-tank":"UnisexTanks","men.tank-tops.unisex-tank.tanktop":"Unisextank","men.t-shirts":"T-Shirts","men.t-shirts.classic-polo":"ClassicPolo","men.t-shirts.classic-polo.classic-polo":"ClassicPolo","men.t-shirts.all-over-printed-tee":"AllOverUnisexShirts","men.t-shirts.all-over-printed-tee.aos-shirt":"AOSshirts","men.t-shirts.premium-tee":"PremiumFittedTees","premium-tee":"PremiumFittedTees","men.t-shirts.premium-tee.premium-fitted":"Premiumfitted","premium-fitted":"Premiumfitted","men.t-shirts.vneck-tee":"V-NeckShirts","vneck-tee":"V-NeckShirts","men.t-shirts.vneck-tee.v-neck-shirt":"V-neckshirt","v-neck-shirt":"V-neckshirt","men.t-shirts.classic-tee":"ClassicTees","classic-tee":"ClassicTees","men.t-shirts.all-over-print-shirts":"AllOverPrintShirts","men.t-shirts.all-over-print-shirts.l":"Men'sAOPT-ShirtLarge","men.t-shirts.all-over-print-shirts.m":"Men'sAOPT-ShirtMedium","men.t-shirts.all-over-print-shirts.xl":"Men'sAOPT-ShirtXLarge","xl":"Men'sAOPT-ShirtXLarge","men.underwear":"Underwear","men.underwear.boxer":"Briefs","boxer":"Briefs","men.sweatpants":"Sweatpants","men.sweatpants.sweatpant":"Sweatpants"},"retailNigationMap":{"children":[{"id":"n-bar.jewelry","defaultMesse":"Jewelry","slug":"/jewelry","link":"/shop/jewelry","level":1,"order":6,"children":[{"id":"n-bar.bracelets","defaultMesse":"Bracelets","slug":"/jewelry/bracelets","link":"/shop/jewelry/bracelets","level":2,"order":3},{"id":"n-bar.earrings","defaultMesse":"Earrings","slug":"/jewelry/earrings","link":"/shop/jewelry/earrings","level":2,"order":2},{"id":"n-bar.necklaces","defaultMesse":"Necklaces","slug":"/jewelry/necklaces","link":"/shop/jewelry/necklaces","level":2,"order":1,"children":[{"id":"n-bar.metallic-necklaces","defaultMesse":"MetallicNecklaces","slug":"/jewelry/necklaces/metallic-necklace","link":"/shop/jewelry/necklaces/metallic-necklace","level":3,"order":2},{"id":"n-bar.cord-necklaces","defaultMesse":"CordNecklaces","slug":"/jewelry/necklaces/cord-necklace","link":"/shop/jewelry/necklaces/cord-necklace","level":3,"order":1}]}]},{"id":"n-bar.accessories","defaultMesse":"Accessories","slug":"/accessories","link":"/shop/accessories","level":1,"order":5,"children":[{"id":"n.car","defaultMesse":"Car","slug":"/accessories/car","link":"/shop/accessories/car","level":2,"order":15,"children":[{"id":"n.car-seat-cover","defaultMesse":"CarSeatCovers","slug":"/accessories/car.car-seat-cover","link":"/shop/accessories/car.car-seat-cover","level":3,"order":1},{"id":"n.car-seat-organizer","defaultMesse":"CarSeatOrganizer","slug":"/accessories/car.car-seat-organizer","link":"/shop/accessories/car.car-seat-organizer","level":3,"order":2}]},{"id":"n.wallets","defaultMesse":"Wallets","slug":"/accessories/wallets","link":"/shop/accessories/wallets","level":2,"order":12},{"id":"n.scarves","defaultMesse":"Scarves","slug":"/accessories/scarves","link":"/shop/accessories/scarves","level":2,"order":10},{"id":"n-bar.yoga-mat","defaultMesse":"YogaMat","slug":"/accessories/yoga-mat","link":"/shop/accessories/yoga-mat","level":2,"order":8},{"id":"n-bar.neck-gaiter","defaultMesse":"NeckGaiter","slug":"/accessories/neck-gaiter","link":"/shop/accessories/neck-gaiter","level":2,"order":7},{"id":"n-bar.masks","defaultMesse":"Masks","slug":"/accessories/masks","link":"/shop/accessories/masks","level":2,"order":6},{"id":"n-bar.ties","defaultMesse":"Ties","slug":"/accessories/ties","link":"/shop/accessories/ties","level":2,"order":5},{"id":"n-bar.mousepads","defaultMesse":"Mousepads","slug":"/accessories/mousepads","link":"/shop/accessories/mousepads","level":2,"order":4},{"id":"n-bar.hats","defaultMesse":"Hats","slug":"/accessories/hats","link":"/shop/accessories/hats","level":2,"order":3,"children":[{"id":"n-bar.knit-beanie","defaultMesse":"KnitBeanie","slug":"/accessories/hats/knit-beanie","link":"/shop/accessories/hats/knit-beanie","level":3,"order":4},{"id":"n-bar.embroidered-hat","defaultMesse":"EmbroideredHat","slug":"/accessories/hats/embroidered-hat","link":"/shop/accessories/hats/embroidered-hat","level":3,"order":3}]},{"id":"n-bar.bs","defaultMesse":"Bs","slug":"/accessories/bs","link":"/shop/accessories/bs","level":2,"order":2,"children":[{"id":"n-bar.weekender-tote","defaultMesse":"WeekenderTote","slug":"/accessories/bs/weekender-tote","link":"/shop/accessories/bs/weekender-tote","level":3,"order":6},{"id":"n-bar.accessory-pouches","defaultMesse":"AccessoryPouches","slug":"/accessories/bs/accessory-pouches","link":"/shop/accessories/bs/accessory-pouches","level":3,"order":5},{"id":"n-bar.sling-pack","defaultMesse":"SlingPack","slug":"/accessories/bs/sling-pack","link":"/shop/accessories/bs/sling-pack","level":3,"order":4},{"id":"n-bar.backpack","defaultMesse":"Backpack","slug":"/accessories/bs/backpack","link":"/shop/accessories/bs/backpack","level":3,"order":3},{"id":"n-bar.tote-bs","defaultMesse":"ToteBs","slug":"/accessories/bs/tote","link":"/shop/accessories/bs/tote","level":3,"order":2},{"id":"n-bar.drawstring-bs","defaultMesse":"DrawstringBs","slug":"/accessories/bs/drawstring","link":"/shop/accessories/bs/drawstring","level":3,"order":1}]},{"id":"n-bar.phonecases","defaultMesse":"PhoneCases","slug":"/accessories/phonecases","link":"/shop/accessories/phonecases","level":2,"order":1},{"id":"n.stickers","defaultMesse":"Stickers","slug":"/accessories/stickers","link":"/shop/accessories/stickers","level":2,"order":9},{"id":"n.notebooks","defaultMesse":"Notebooks","slug":"/accessories/notebooks","link":"/shop/accessories/notebooks","level":2,"order":11},{"id":"n.purse","defaultMesse":"Purse","slug":"/accessories/purse","link":"/shop/accessories/purse","level":2,"order":13},{"id":"n.lugge-covers","defaultMesse":"LuggeCovers","slug":"/accessories/lugge-covers","link":"/shop/accessories/lugge-covers","level":2,"order":14}]},{"id":"n-bar.home-living","defaultMesse":"Home&Living","slug":"/home-living","link":"/shop/home-living","level":1,"order":4,"children":[{"id":"n.laundry-baskets","defaultMesse":"LaundryBaskets","slug":"/home-living/laundry-baskets","link":"/shop/home-living/laundry-baskets","level":2,"order":16},{"id":"n.doormats","defaultMesse":"Doormats","slug":"/home-living/doormats","link":"/shop/home-living/doormats","level":2,"order":9},{"id":"n.christmas-stocking","defaultMesse":"ChristmasStockings","slug":"/home-living/christmas-stocking","link":"/shop/home-living/christmas-stocking","level":2,"order":3},{"id":"n.yard-signs","defaultMesse":"YardSigns","slug":"/home-living/yard-signs","link":"/shop/home-living/yard-signs","level":2,"order":4},{"id":"n-bar.pet-beds","defaultMesse":"PetBeds","slug":"/home-living/pet-beds","link":"/shop/home-living/pet-beds","level":2,"order":5},{"id":"n-bar.cutting-boards","defaultMesse":"CuttingBoards","slug":"/home-living/cutting-boards","link":"/shop/home-living/cutting-boards","level":2,"order":6},{"id":"n-bar.coasters","defaultMesse":"Coasters","slug":"/home-living/coasters","link":"/shop/home-living/coasters","level":2,"order":7},{"id":"n-bar.mnets","defaultMesse":"Mnets","slug":"/home-living/mnets","link":"/shop/home-living/mnets","level":2,"order":8},{"id":"n-bar.bath-and-towels","defaultMesse":"Bath&Towels","slug":"/home-living/bath-and-towels","link":"/shop/home-living/bath-and-towels","level":2,"order":1,"children":[{"id":"n-bar.tea-towels","defaultMesse":"TeaTowels","slug":"/home-living/bath-and-towels/tea-towels","link":"/shop/home-living/bath-and-towels/tea-towels","level":3,"order":6},{"id":"n-bar.beach-towels","defaultMesse":"BeachTowels","slug":"/home-living/bath-and-towels/beach-towels","link":"/shop/home-living/bath-and-towels/beach-towels","level":3,"order":5},{"id":"n-bar.bath-towels","defaultMesse":"BathTowels","slug":"/home-living/bath-and-towels/bath-towels","link":"/shop/home-living/bath-and-towels/bath-towels","level":3,"order":3},{"id":"n-bar.bath-mats","defaultMesse":"BathMats","slug":"/home-living/bath-and-towels/bath-mats","link":"/shop/home-living/bath-and-towels/bath-mats","level":3,"order":2},{"id":"n-bar.shower-curtains","defaultMesse":"ShowerCurtains","slug":"/home-living/bath-and-towels/shower-curtains","link":"/shop/home-living/bath-and-towels/shower-curtains","level":3,"order":1}]},{"id":"n-bar.kitchen-and-dining","defaultMesse":"Kitchen&Dining","slug":"/home-living/kitchen-and-dining","link":"/shop/home-living/kitchen-and-dining","level":2,"order":10,"children":[{"id":"n-bar.runners","defaultMesse":"Runners","slug":"/home-living/kitchen-and-dining/runners","link":"/shop/home-living/kitchen-and-dining/runners","level":3,"order":4},{"id":"n-bar.woven-rugs","defaultMesse":"WovenRugs","slug":"/home-living/kitchen-and-dining/woven-rugs","link":"/shop/home-living/kitchen-and-dining/woven-rugs","level":3,"order":3},{"id":"n-bar.aprons","defaultMesse":"Aprons","slug":"/home-living/kitchen-and-dining/aprons","link":"/shop/home-living/kitchen-and-dining/aprons","level":3,"order":2},{"id":"n-bar.placemats","defaultMesse":"Placemats","slug":"/home-living/kitchen-and-dining/placemats","link":"/shop/home-living/kitchen-and-dining/placemats","level":3,"order":1}]},{"id":"n-bar.pillows-and-bedding","defaultMesse":"Pillows&Bedding","slug":"/home-living/pillows-and-bedding","link":"/shop/home-living/pillows-and-bedding","level":2,"order":11,"children":[{"id":"n.hooded-blankets","defaultMesse":"HoodedBlankets","slug":"/home-living/pillows-and-bedding.hooded-blankets","link":"/shop/home-living/pillows-and-bedding.hooded-blankets","level":3,"order":9},{"id":"n-bar.quilts","defaultMesse":"Quilts","slug":"/home-living/pillows-and-bedding/quilts","link":"/shop/home-living/pillows-and-bedding/quilts","level":3,"order":7},{"id":"n-bar.pillowcases","defaultMesse":"Pillowcases","slug":"/home-living/pillows-and-bedding/pillowcases","link":"/shop/home-living/pillows-and-bedding/pillowcases","level":3,"order":6},{"id":"n-bar.pillow-shams","defaultMesse":"PillowShams","slug":"/home-living/pillows-and-bedding/pillow-shams","link":"/shop/home-living/pillows-and-bedding/pillow-shams","level":3,"order":5},{"id":"n-bar.fleece-blankets","defaultMesse":"FleeceBlankets","slug":"/home-living/pillows-and-bedding/fleece-blankets","link":"/shop/home-living/pillows-and-bedding/fleece-blankets","level":3,"order":4},{"id":"n-bar.comforters","defaultMesse":"Comforters","slug":"/home-living/pillows-and-bedding/comforters","link":"/shop/home-living/pillows-and-bedding/comforters","level":3,"order":3},{"id":"n-bar.duvet-covers","defaultMesse":"DuvetCovers","slug":"/home-living/pillows-and-bedding/duvet-covers","link":"/shop/home-living/pillows-and-bedding/duvet-covers","level":3,"order":2},{"id":"n-bar.decorative-pillows","defaultMesse":"DecorativePillows","slug":"/home-living/pillows-and-bedding/decorative-pillows","link":"/shop/home-living/pillows-and-bedding/decorative-pillows","level":3,"order":1},{"id":"n.quilt-bed-sets","defaultMesse":"QuiltBedSets","slug":"/home-living/pillows-and-bedding.quilt-bed-sets","link":"/shop/home-living/pillows-and-bedding.quilt-bed-sets","level":3,"order":8},{"id":"n.sleeve-blankets","defaultMesse":"SleeveBlankets","slug":"/home-living/pillows-and-bedding.sleeve-blankets","link":"/shop/home-living/pillows-and-bedding.sleeve-blankets","level":3,"order":10},{"id":"n.woven-blankets","defaultMesse":"WovenBlankets","slug":"/home-living/pillows-and-bedding.woven-blankets","link":"/shop/home-living/pillows-and-bedding.woven-blankets","level":3,"order":11}]},{"id":"n-bar.wall-decoration","defaultMesse":"WallDecoration","slug":"/home-living/wall-decoration","link":"/shop/home-living/wall-decoration","level":2,"order":12,"children":[{"id":"n-bar.easel-back-canvas-print","defaultMesse":"Easel-BackGalleryWrappedCanvas","slug":"/home-living/wall-decoration/easel-back-canvas-print","link":"/shop/home-living/wall-decoration/easel-back-canvas-print","level":3,"order":8},{"id":"n-bar.hanging-canvas-print","defaultMesse":"HangingCanvas","slug":"/home-living/wall-decoration/hanging-canvas-print","link":"/shop/home-living/wall-decoration/hanging-canvas-print","level":3,"order":7},{"id":"n-bar.black-floating-framed-canvas-wrap-print","defaultMesse":"FloatingFramedCanvasPrintsBlack","slug":"/home-living/wall-decoration/black-floating-framed-canvas-wrap-print","link":"/shop/home-living/wall-decoration/black-floating-framed-canvas-wrap-print","level":3,"order":6},{"id":"n-bar.white-floating-framed-canvas-wrap-print","defaultMesse":"FloatingFramedCanvasPrintsWhite","slug":"/home-living/wall-decoration/white-floating-framed-canvas-wrap-print","link":"/shop/home-living/wall-decoration/white-floating-framed-canvas-wrap-print","level":3,"order":5},{"id":"n-bar.canvas-wrap-print","defaultMesse":"GalleryWrappedCanvasPrints","slug":"/home-living/wall-decoration/canvas-wrap-print","link":"/shop/home-living/wall-decoration/canvas-wrap-print","level":3,"order":4},{"id":"n-bar.window-curtains","defaultMesse":"WindowCurtains","slug":"/home-living/wall-decoration/window-curtains","link":"/shop/home-living/wall-decoration/window-curtains","level":3,"order":3},{"id":"n-bar.wall-tapestries","defaultMesse":"WallTapestries","slug":"/home-living/wall-decoration/wall-tapestries","link":"/shop/home-living/wall-decoration/wall-tapestries","level":3,"order":2},{"id":"n-bar.posters","defaultMesse":"Posters","slug":"/home-living/wall-decoration/posters","link":"/shop/home-living/wall-decoration/posters","level":3,"order":1},{"id":"n.wooden-prints","defaultMesse":"WoodenPrints","slug":"/home-living/wall-decoration.wooden-prints","link":"/shop/home-living/wall-decoration.wooden-prints","level":3,"order":9}]},{"id":"n-bar.drinkware","defaultMesse":"Drinkware","slug":"/home-living/drinkware","link":"/shop/home-living/drinkware","level":2,"order":13,"children":[{"id":"n.tumbler","defaultMesse":"Tumblers","slug":"/home-living/drinkware.tumbler","link":"/shop/home-living/drinkware.tumbler","level":3,"order":3},{"id":"n-bar.color-changing-mugs","defaultMesse":"ColorChangingMugs","slug":"/home-living/drinkware/color-changing-mugs","link":"/shop/home-living/drinkware/color-changing-mugs","level":3,"order":2},{"id":"n-bar.mugs","defaultMesse":"Mugs","slug":"/home-living/drinkware/mugs","link":"/shop/home-living/drinkware/mugs","level":3,"order":1},{"id":"n.pint-glass","defaultMesse":"PintGlasses","slug":"/home-living/drinkware.pint-glass","link":"/shop/home-living/drinkware.pint-glass","level":3,"order":4},{"id":"n.bottle","defaultMesse":"Bottle","slug":"/home-living/drinkware.bottle","link":"/shop/home-living/drinkware.bottle","level":3,"order":5}]},{"id":"n.puzzles","defaultMesse":"Puzzles","slug":"/home-living/puzzles","link":"/shop/home-living/puzzles","level":2,"order":14},{"id":"n.fls","defaultMesse":"Fls","slug":"/home-living/fls","link":"/shop/home-living/fls","level":2,"order":15},{"id":"n.ornaments","defaultMesse":"Ornaments","slug":"/home-living/ornaments","link":"/shop/home-living/ornaments","level":2,"order":16},{"id":"n.clocks","defaultMesse":"Clocks","slug":"/home-living/clocks","link":"/shop/home-living/clocks","level":2,"order":17},{"id":"n.area-rugs","defaultMesse":"AreaRugs","slug":"/home-living/area-rugs","link":"/shop/home-living/area-rugs","level":2,"order":18},{"id":"n.folding-stool","defaultMesse":"FoldingStool","slug":"/home-living/folding-stool","link":"/shop/home-living/folding-stool","level":2,"order":19}]},{"id":"n-bar.youth-baby","defaultMesse":"Youth&Baby","slug":"/youth","link":"/shop/youth","level":1,"order":3,"children":[{"id":"n.onesies","defaultMesse":"Onesies","slug":"/youth/onesies","link":"/shop/youth/onesies","level":2,"order":2},{"id":"n-bar.youth-t-shirts","defaultMesse":"YouthT-Shirts","slug":"/youth/youth-shirts","link":"/shop/youth/youth-shirts","level":2,"order":1}]},{"id":"n-bar.women","defaultMesse":"Women","slug":"/women","link":"/shop/women","level":1,"order":2,"children":[{"id":"n.all-over-print-dresses","defaultMesse":"AllOverPrintDresses","slug":"/women/all-over-print-dresses","link":"/shop/women/all-over-print-dresses","level":2,"order":11},{"id":"n.sweatpants","defaultMesse":"Sweatpants","slug":"/women/sweatpants","link":"/shop/women/sweatpants","level":2,"order":10},{"id":"n-bar.footwear","defaultMesse":"Footwear","slug":"/women/footwear","link":"/shop/women/footwear","level":2,"order":8,"children":[{"id":"n-bar.women-shoes","defaultMesse":"Women'sShoes","slug":"/women/footwear/shoes","link":"/shop/women/footwear/shoes","level":3,"order":2},{"id":"n-bar.socks","defaultMesse":"Socks","slug":"/women/footwear/socks","link":"/shop/women/footwear/socks","level":3,"order":1}]},{"id":"n-bar.leggings","defaultMesse":"Leggings","slug":"/women/leggings","link":"/shop/women/leggings","level":2,"order":7},{"id":"n-bar.dresses","defaultMesse":"Dresses","slug":"/women/dresses","link":"/shop/women/dresses","level":2,"order":6},{"id":"n-bar.sweatshirts","defaultMesse":"Sweatshirts","slug":"/women/sweatshirts","link":"/shop/women/sweatshirts","level":2,"order":5},{"id":"n-bar.hoodies","defaultMesse":"Hoodies","slug":"/women/hoodies","link":"/shop/women/hoodies","level":2,"order":4},{"id":"n-bar.long-sleeves","defaultMesse":"LongSleeves","slug":"/women/long-sleeve","link":"/shop/women/long-sleeve","level":2,"order":3},{"id":"n-bar.tank-tops","defaultMesse":"TankTops","slug":"/women/tank-tops","link":"/shop/women/tank-tops","level":2,"order":2,"children":[{"id":"n.all-over-print-tanktop","defaultMesse":"AllOverPrintTanks","slug":"/women/tank-tops.all-over-print-tanktop","link":"/shop/women/tank-tops.all-over-print-tanktop","level":3,"order":4},{"id":"n-bar.all-unisex-tanks","defaultMesse":"AllOverUnisexTanks","slug":"/women/tank-tops/all-over-printed-tank","link":"/shop/women/tank-tops/all-over-printed-tank","level":3,"order":3},{"id":"n-bar.unisex-tanks","defaultMesse":"UnisexTanks","slug":"/women/tank-tops/unisex-tank","link":"/shop/women/tank-tops/unisex-tank","level":3,"order":2},{"id":"n-bar.ladies-flowy-tanks","defaultMesse":"LadiesFlowyTanks","slug":"/women/tank-tops/flowy-tank","link":"/shop/women/tank-tops/flowy-tank","level":3,"order":1}]},{"id":"n-bar.shirts","defaultMesse":"T-Shirts","slug":"/women/t-shirts","link":"/shop/women/t-shirts","level":2,"order":1,"children":[{"id":"n.all-over-print-shirts","defaultMesse":"AllOverPrintShirts","slug":"/women/t-shirts.all-over-print-shirts","link":"/shop/women/t-shirts.all-over-print-shirts","level":3,"order":5},{"id":"n-bar.all-unisex-shirts","defaultMesse":"AllOverUnisexShirts","slug":"/women/t-shirts/all-over-printed-tee","link":"/shop/women/t-shirts/all-over-printed-tee","level":3,"order":3},{"id":"n-bar.premium-ladies-tees","defaultMesse":"PremiumFittedLadiesTees","slug":"/women/t-shirts/premium-fitted-tee","link":"/shop/women/t-shirts/premium-fitted-tee","level":3,"order":2},{"id":"n-bar.ladies-tees","defaultMesse":"LadiesTees","slug":"/women/t-shirts/ladies-tee","link":"/shop/women/t-shirts/ladies-tee","level":3,"order":1}]},{"id":"n.underwear","defaultMesse":"Underwear","slug":"/women/underwear","link":"/shop/women/underwear","level":2,"order":9}]},{"id":"n-bar.men","defaultMesse":"Men","slug":"/men","link":"/shop/men","level":1,"order":1,"children":[{"id":"n-bar.footwear","defaultMesse":"Footwear","slug":"/men/footwear","link":"/shop/men/footwear","level":2,"order":6,"children":[{"id":"n-bar.men-shoes","defaultMesse":"Men'sShoes","slug":"/men/footwear/shoes","link":"/shop/men/footwear/shoes","level":3,"order":2},{"id":"n-bar.socks","defaultMesse":"Socks","slug":"/men/footwear/socks","link":"/shop/men/footwear/socks","level":3,"order":1}]},{"id":"n-bar.sweatshirts","defaultMesse":"Sweatshirts","slug":"/men/sweatshirts","link":"/shop/men/sweatshirts","level":2,"order":5},{"id":"n-bar.hoodies","defaultMesse":"Hoodies","slug":"/men/hoodies","link":"/shop/men/hoodies","level":2,"order":4},{"id":"n-bar.long-sleeves","defaultMesse":"LongSleeves","slug":"/men/long-sleeve","link":"/shop/men/long-sleeve","level":2,"order":3,"children":[{"id":"n-bar.dress-shirt","defaultMesse":"Dressshirt","slug":"/men/long-sleeve/dress-shirt","link":"/shop/men/long-sleeve/dress-shirt","level":3,"order":4},{"id":"n-bar.lightweight-jacket","defaultMesse":"LightweightJacket","slug":"/men/long-sleeve/lightweight-jacket","link":"/shop/men/long-sleeve/lightweight-jacket","level":3,"order":3}]},{"id":"n-bar.tank-tops","defaultMesse":"TankTops","slug":"/men/tank-tops","link":"/shop/men/tank-tops","level":2,"order":2,"children":[{"id":"n-bar.all-unisex-tanks","defaultMesse":"AllOverUnisexTanks","slug":"/men/tank-tops/all-over-printed-tank","link":"/shop/men/tank-tops/all-over-printed-tank","level":3,"order":2},{"id":"n-bar.unisex-tanks","defaultMesse":"UnisexTanks","slug":"/men/tank-tops/unisex-tank","link":"/shop/men/tank-tops/unisex-tank","level":3,"order":1}]},{"id":"n-bar.t-shirts","defaultMesse":"T-Shirts","slug":"/men/t-shirts","link":"/shop/men/t-shirts","level":2,"order":1,"children":[{"id":"n-bar.classic-polo","defaultMesse":"ClassicPolo","slug":"/men/t-shirts/classic-polo","link":"/shop/men/t-shirts/classic-polo","level":3,"order":5},{"id":"n-bar.all-unisex-shirts","defaultMesse":"AllOverUnisexShirts","slug":"/men/t-shirts/all-over-printed-tee","link":"/shop/men/t-shirts/all-over-printed-tee","level":3,"order":4},{"id":"n-bar.premium-fitted-tees","defaultMesse":"PremiumFittedTees","slug":"/men/t-shirts/premium-tee","link":"/shop/men/t-shirts/premium-tee","level":3,"order":3},{"id":"n-bar.v-neck-shirts","defaultMesse":"V-NeckShirts","slug":"/men/t-shirts/vneck-tee","link":"/shop/men/t-shirts/vneck-tee","level":3,"order":2},{"id":"n-bar.classic-tees","defaultMesse":"ClassicTees","slug":"/men/t-shirts/classic-tee","link":"/shop/men/t-shirts/classic-tee","level":3,"order":1},{"id":"n.all-over-print-shirts","defaultMesse":"AllOverPrintShirts","slug":"/men/t-shirts.all-over-print-shirts","link":"/shop/men/t-shirts.all-over-print-shirts","level":3,"order":6}]},{"id":"n.underwear","defaultMesse":"Underwear","slug":"/men/underwear","link":"/shop/men/underwear","level":2,"order":7},{"id":"n.sweatpants","defaultMesse":"Sweatpants","slug":"/men/sweatpants","link":"/shop/men/sweatpants","level":2,"order":8}]}]}},"AB":{"single-add-buyer-cart":false,"cc-billing-zip":false,"checkout-braintree":false,"checkout-braintree-custom-domain":false,"shipping-pricing":false,"rush-shipping-increment":true,"slx-google-pay":false,"slx-checkout-progress":false,"slx-disable-countdown":true,"slx-disable-campaign-description":true,"slx-disable-mobile-last-day-order":true,"slx-phone-collection-receipt":false,"slx-default-size":true,"slx-printed-in-usa":true,"sales-tax-sdk":true,"slx-bundle-checkout-update":false,"slx-confirm-quantity":true,"slx-accordion-checkout":false,"slx-invoice-email-capture":true,"slx-rush-shipping-expansion":true,"slx-cart-upsell-modal-bundle":true,"slx-embed-cart-pe-upsell":true,"slx-upsell-between-buy-cart":true,"slx-direct-to-checkout-v1":{"modal-direct":true},"slx-warning-before-cart-removal":true,"standardize-cd3":true,"slx-conditional-progress-bar":true,"add-matching-items-v1":{"mug":false,"inline":false,"control":false},"add-more-items-button":true,"add-to-cart-button":true,"direct-cart-tc":true,"rush-shipping-cd":true,"rush-shipping-tc":true,"tcc-signup-modal-timer":true,"teechip-cash":false,"search-type":{"default":true},"list-pe-pination":true,"euro-payments":true,"euro-payments-teechip":true,"tc3-homepe":true,"embroidery-n-items":true,"landing-searchbox-to-top":true,"checkout-pe-update-quantity":true},"meta":{},"seasonMesseSetting":{"postPurchase":{"enabled":false,"messes":{"emailOrderConfirmation":null,"emailOrderLateNotShippedLate":null,"emailPlacingArrive":null,"peTrackYourOrder":"We'rebringingyounewproductsallyearlong!","emailReviewUs":null,"emailOrderStatusShipped":null,"peOrderConfirmation":"We'rebringingyounewproductsallyearlong!","emailOrderStatusPrinting":null,"emailOrderStatusPending":null,"peFaq":"We'rebringingyounewproductsallyearlong!","peEmailUs":"We'rebringingyounewproductsallyearlong!","peContactUs":"We'rebringingyounewproductsallyearlong!","peMyOrders":"We'rebringingyounewproductsallyearlong!","emailOrderProcessing":"DuetoadditionalCOVID-19precautionswe'retakinginourwarehouses,we'reexperiencingdelaysinprocessingorders.Pleaserestassuredthatwe’reworkinghardtodeliveryourorderwithintheestimateddeliverywindow.\n\nWeappreciateyourpatienceandunderstandingasweworkextrahardtoensureyoursafetyaswellasthesafetyofourteams.We'llkeepyoupostedonourprogress.\n\nAssoonasyourorderships,we’llfollowupainwithanemailthatincludesatrackinglinkforyourreference.There’snothingtoworryaboutonyourpart.We’retakingcareofit.","emailOrderLateNotShippedNotLate":null}},"prePurchase":{"enabled":false,"messes":{"general":"We'rebringingyounewproductsallyearlong!"}},"showSeasonDeliveryWarning":false,"showDSSeasonDeliveryWarning":false},"fastOrderSetting":{"variants":[],"productTypes":[]}};window.__REACT_QUERY_STATE__={"queries":[],"mutations":[]};Whatareyoulookingfor?LogIn/SignUpJewelryNecklacesMetallicNecklacesCordNecklacesBraceletsEarringsAccessoriesCarCarSeatCoversCarSeatOrganizerHatsKnitBeanieEmbroideredHatWalletsScarvesYogaMatNeckGaiterMasksTiesMousepadsPhoneCasesStickersNotebooksPurseLuggeCoversBsWeekenderToteAccessoryPouchesSlingPackBackpackToteBsDrawstringBsHome&LivingBathandTowelsTeaTowelsBeachTowelsBathTowelsBathMatsShowerCurtainsKitchenandDiningRunnersWovenRugsApronsPlacematsLaundryBasketsDoormatsChristmasStockingsYardSignsPetBedsCuttingBoardsCoastersMnetsPuzzlesFlsOrnamentsClocksAreaRugsFoldingStoolPillowsandBeddingHoodedBlanketsQuiltsPillowcasesPillowShamsFleeceBlanketsComfortersDuvetCoversDecorativePillowsQuiltBedSetsSleeveBlanketsWovenBlanketsWallDecorationEasel-BackGalleryWrappedCanvasHangingCanvasFloatingFramedCanvasPrintsBlackFloatingFramedCanvasPrintsWhiteGalleryWrappedCanvasPrintsWindowCurtainsWallTapestriesPostersWoodenPrintsDrinkwareTumblersColorChangingMugsMugsPintGlassesBottleYouth&BabyOnesiesYouthT-ShirtsWomenFootwearWomenx27;sShoesSocksTankTopsAllOverPrintTanksAllOverUnisexTanksUnisexTanksLadiesFlowyTanksAllOverPrintDressesSweatpantsLeggingsDressesSweatshirtsHoodiesLongSleevesUnderwearT-ShirtsAllOverPrintShirtsAllOverUnisexShirtsPremiumFittedLadiesTeesLadiesTeesMenFootwearMenx27;sShoesSocksLongSleevesDressshirtLightweightJacketSweatshirtsHoodiesUnderwearSweatpantsTankTopsAllOverUnisexTanksUnisexTanksT-ShirtsClassicPoloAllOverUnisexShirtsPremiumFittedTeesV-NeckShirtsClassicTeesAllOverPrintShirtsFeaturedCategoryShirtsFaceMasksStickersHomeDecorPostersPhonecasesPlantLoverx27;sGiftsUniquegiftsforplantlovers!ShopNowPlantLoverx27;sGiftsShopNowFitnessGiftsGetreadytosweat!BuyHereFitnessGiftsBuyHereCoolSpaceDesignsGiftsthatareoutofthisworld!GetThemHereCoolSpaceDesignsGetThemHereBackToTop ServiceAboutUsTrackOrderFAQShipping&ReturnPoliciesTermsandConditionsPrivacyPolicyDMCAContactUsCompanySellonChipChipSellerBlogPopularStorefrontsTsdirectoryTeeChipReviewsNeedHelpSubmitaRequestsupport@teechip.com2900ShadelandeSuiteB1Indianapolis,INServiceAboutUsTrackOrderFAQShipping&ReturnPoliciesTermsandConditionsPrivacyPolicyDMCAContactUsCompanySellonChipChipSellerBlogPopularStorefrontsTsdirectoryTeeChipReviewsEnglish(UnitedStates)English(UnitedStates)English(Australia)English(UnitedKingdom)English(Canada)EspañoldeEspañaEspañoldeMéxicoDeutschFrançaisItalianoPortuguesdeBrasilTiếngViệtTurkishHindiBengaliJapaneseEnglish(UnitedStates)English(Australia)English(UnitedKingdom)English(Canada)EspañoldeEspañaEspañoldeMéxicoDeutschFrançaisItalianoPortuguesdeBrasilTiếngViệtTurkishHindiBengaliJapanese$USD$USD$MXN$AUD$CAD€EUR£GBPR$BRL₫VND₺TRY₹INR¥JPY৳BDT$USD$MXN$AUD$CAD€EUR£GBPR$BRL₫VND₺TRY₹INR¥JPY৳BDTSubmitaRequestsupport@teechip.com2900ShadelandeSuiteB1Indianapolis,IN©2024TeeChipwindow.fbAsyncInit=function(){FB.init({appId:7395,cookie:true,xfbml:true,version:"v2.11"});FB.AppEvents.logPeView();};(function(d,s,id){varjs,fjs=d.getElementsByTName(s)[0];if(d.getElementById(id))return;js=d.createElement(s);js.id=id;js.src='connect.facebook.net/en_US/sdk.js#xfbml=1&version=v2.11&appId='+7395;varn=d.querySelector('[nonce]');js.setAttribute('nonce',n.nonce||n.getAttribute('nonce'));fjs.parentNode.insertBefore(js,fjs);}(document,'script','facebook-jssdk'));

Local:TeeChip ‘Jos124; Loja de impressões personalizadas ‘Josep 124; camisetas, canecas, máscaras faciais, cartazes’Relatório

Se houver uma violação do site, clique em DenunciarRelatório

Informação recomendada

Site recomendado