Como construir um site em 2022: Guia Passo a Passo Completo

  • 2022-01-04Data de coleta
  • 2022-02-15Atualizada
Como construir um site em 2022: Guia Passo a Passo Completo
  • Endereço do website:websiteplanet.com
  • IP do servidor:172.66.40.194
  • Descrição do Site:Quer construir um site? Você não precisa de know-how t écnico para comprar um domínio, escolher um web builder, projetar um logo, e obter conteúdo online. Leia nossos passos para começar.

nome do domínio:websiteplanet.comAvaliação

cerca de 1000~20000

nome do domínio:websiteplanet.comfluxo

560

nome do domínio:websiteplanet.comBom ou mal

Prosperidade e declínio. Altos e baixos não são frequentes boa sorte traz azar

local na rede Internet:Como construir um site em 2022: Guia Passo a Passo CompletoPesos

2

local na rede Internet:Como construir um site em 2022: Guia Passo a Passo CompletoIP

172.66.40.194

local na rede Internet:Como construir um site em 2022: Guia Passo a Passo Completocontente

(window.NREUM||(NREUM={})).init={ajax:{deny_list:["bam.nr-data.net"]}};(window.NREUM||(NREUM={})).loader_config={licenseKey:"e4b2dce614",applicationID:"97"};;/*!Forlicenseinformationpleaseseenr-loader-rum-1.260.1.min.js.LICENSE.txt*/(()=>{vare,t,r={234:(e,t,r)=>{"usestrict";r.d(t,{P_:()=>v,Mt:()=>b,C5:()=>s,OP:()=>k,lF:()=>P,Yu:()=>_,Dg:()=>m,CX:()=>c,GE:()=>w,sU:()=>N});varn=r(8632),i=r(9567);consto={beacon:n.ce.beacon,errorBeacon:n.ce.errorBeacon,licenseKey:void0,applicationID:void0,sa:void0,queueTime:void0,applicationTime:void0,ttGuid:void0,user:void0,account:void0,product:void0,extra:void0,jsAttributes:{},userAttributes:void0,atts:void0,transactionName:void0,tNamePlain:void0},a={};functions(e){if(!e)thrownewError("Allinfoobjectsrequireanentidentifier!");if(!a[e])thrownewError("Infofor".concat(e,"wasneverset"));returna[e]}functionc(e,t){if(!e)thrownewError("Allinfoobjectsrequireanentidentifier!");a[e]=(0,i.D)(t,o);constr=(0,n.ek)(e);r&&(r.info=a[e])}constu=e=>{if(!e||"string"!=typeofe)return!1;try{document.createDocumentFrment().querySelector(e)}catch{return!1}return!0};vard=r(7056),l=r(50);constf="[data-nr-mask]",g=()=>{conste={mask_selector:"*",block_selector:"[data-nr-block]",mask_input_options:{color:!1,date:!1,"datetime-local":!1,email:!1,month:!1,number:!1,range:!1,search:!1,tel:!1,text:!1,time:!1,url:!1,week:!1,textarea:!1,select:!1,password:!0}};return{feature_fls:[],proxy:{assets:void0,beacon:void0},privacy:{cookies_enabled:!0},ajax:{deny_list:void0,block_internal:!0,enabled:!0,harvestTimeSeconds:10,autoStart:!0},distributed_tracing:{enabled:void0,exclude_newrelic_header:void0,cors_use_newrelic_header:void0,cors_use_tracecontext_headers:void0,allowed_origins:void0},session:{expiresMs:d.oD,inactiveMs:d.Hb},ssl:void0,obfuscate:void0,jserrors:{enabled:!0,harvestTimeSeconds:10,autoStart:!0},metrics:{enabled:!0,autoStart:!0},pe_action:{enabled:!0,harvestTimeSeconds:30,autoStart:!0},pe_view_event:{enabled:!0,autoStart:!0},pe_view_timing:{enabled:!0,harvestTimeSeconds:30,long_task:!1,autoStart:!0},session_trace:{enabled:!0,harvestTimeSeconds:10,autoStart:!0},harvest:{tooManyRequestsDelay:60},session_replay:{autoStart:!0,enabled:!1,harvestTimeSeconds:60,preload:!1,sampling_rate:10,error_sampling_rate:100,collect_fonts:!1,inline_imes:!1,inline_stylesheet:!0,mask_all_inputs:!0,getmask_text_selector(){returne.mask_selector},setmask_text_selector(t){u(t)?e.mask_selector="".concat(t,",").concat(f):""===t||null===t?e.mask_selector=f:(0,l.Z)("Aninvalidsession_replay.mask_selectorwasprovided.'*'willbeused.",t)},getblock_class(){return"nr-block"},getignore_class(){return"nr-ignore"},getmask_text_class(){return"nr-mask"},getblock_selector(){returne.block_selector},setblock_selector(t){u(t)?e.block_selector+=",".concat(t):""!==t&&(0,l.Z)("Aninvalidsession_replay.block_selectorwasprovidedandwillnotbeused",t)},getmask_input_options(){returne.mask_input_options},setmask_input_options(t){t&&"object"==typeoft?e.mask_input_options={...t,password:!0}:(0,l.Z)("Aninvalidsession_replay.mask_input_optionwasprovidedandwillnotbeused",t)}},spa:{enabled:!0,harvestTimeSeconds:10,autoStart:!0},soft_nigations:{enabled:!0,harvestTimeSeconds:10,autoStart:!0}}},p={},h="Allconfigurationobjectsrequireanentidentifier!";functionv(e){if(!e)thrownewError(h);if(!p[e])thrownewError("Configurationfor".concat(e,"wasneverset"));returnp[e]}functionm(e,t){if(!e)thrownewError(h);p[e]=(0,i.D)(t,g());constr=(0,n.ek)(e);r&&(r.init=p[e])}functionb(e,t){if(!e)thrownewError(h);varr=v(e);if(r){for(varn=t.split("."),i=0;i{"usestrict";r.d(t,{D:()=>i});varn=r(50);functioni(e,t){try{if(!e||"object"!=typeofe)return(0,n.Z)("SettingaConfigurablerequiresanobjectasinput");if(!t||"object"!=typeoft)return(0,n.Z)("SettingaConfigurablerequiresamodeltosetitsinitialproperties");constr=Object.create(Object.getPrototypeOf(t),Object.getOwnPropertyDescriptors(t)),o=0===Object.keys(r).length?e:r;for(letaino)if(void0!==e[a])try{if(null===e[a]){r[a]=null;continue}Array.isArray(e[a])&&Array.isArray(t[a])?r[a]=Array.from(newSet([...e[a],...t[a]])):"object"==typeofe[a]&&"object"==typeoft[a]?r[a]=i(e[a],t[a]):r[a]=e[a]}catch(e){(0,n.Z)("AnerroroccurredwhilesettingapropertyofaConfigurable",e)}returnr}catch(e){(0,n.Z)("AnerroroccuredwhilesettingaConfigurable",e)}}},6818:(e,t,r)=>{"usestrict";r.d(t,{Re:()=>i,gF:()=>o,q4:()=>n});constn="1.260.1",i="PROD",o="CDN"},385:(e,t,r)=>{"usestrict";r.d(t,{Nk:()=>l,Tt:()=>c,_A:()=>a,iS:()=>s,il:()=>i,sK:()=>f,ux:()=>u,v6:()=>o,w1:()=>d});varn=r(7894);consti="undefined"!=typeofwindow&&!!window.document,o="undefined"!=typeofWorkerGlobalScope&&("undefined"!=typeofself&&selfinstanceofWorkerGlobalScope&&self.nigatorinstanceofWorkerNigator||"undefined"!=typeofglobalThis&&globalThisinstanceofWorkerGlobalScope&&globalThis.nigatorinstanceofWorkerNigator),a=i?window:"undefined"!=typeofWorkerGlobalScope&&("undefined"!=typeofself&&selfinstanceofWorkerGlobalScope&&self||"undefined"!=typeofglobalThis&&globalThisinstanceofWorkerGlobalScope&&globalThis),s=Boolean("hidden"===a?.document?.visibilityState),c=/iPad|iPhone|iPod/.test(a.nigator?.userent),u=c&&"undefined"==typeofSharedWorker,d=((()=>{conste=a.nigator?.userent?.match(/Firefox[/\s](\d+\.\d+)/);Array.isArray(e)&&e.length>=2&&e[1]})(),Boolean(i&&window.document.documentMode)),l=!!a.nigator?.sendBeacon,f=Date.now()-(0,n.z)()},1117:(e,t,r)=>{"usestrict";r.d(t,{w:()=>o});varn=r(50);consti={entIdentifier:"",ee:void0};classo{constructor(e){try{if("object"!=typeofe)return(0,n.Z)("sharedcontextrequiresanobjectasinput");this.sharedContext={},Object.assign(this.sharedContext,i),Object.entries(e).forEach((e=>{let[t,r]=e;Object.keys(i).includes(t)&&(this.sharedContext[t]=r)}))}catch(e){(0,n.Z)("AnerroroccurredwhilesettingSharedContext",e)}}}},8e3:(e,t,r)=>{"usestrict";r.d(t,{LP:()=>l,RP:()=>c,o5:()=>u});varn=r(8325),i=r(1284),o=r(4322),a=r(3325);consts={};functionc(e,t){constr={sted:!1,priority:a.p[t]||0};d(e),s[e].get(t)||s[e].set(t,r)}functionu(e,t){d(e),s[e].get(t)&&s[e].delete(t),s[e].size&&f(e)}functiond(e){if(!e)thrownewError("entIdentifierrequired");s[e]||(s[e]=newMap)}functionl(){lete=arguments.length>0&&void0!==arguments[0]?arguments[0]:"",t=arguments.length>1&&void0!==arguments[1]?arguments[1]:"feature",r=arguments.length>2&&void0!==arguments[2]&&arguments[2];if(d(e),!e||!s[e].get(t)||r)returng(e,t);s[e].get(t).sted=!0,f(e)}functionf(e){constt=Array.from(s[e]);t.every((e=>{let[t,r]=e;returnr.sted}))&&(t.sort(((e,t)=>e[1].priority-t[1].priority)),t.forEach((t=>{let[r]=t;s[e].delete(r),g(e,r)})))}functiong(e,t){constr=e?n.ee.get(e):n.ee,a=o.X.handlers;if(r.backlog&&a){vars=r.backlog[t],c=a[t];if(c){for(varu=0;s&&u{"usestrict";r.d(t,{A:()=>c,ee:()=>u});varn=r(8632),i=r(2210),o=r(234);classa{constructor(e){this.contextId=e}}vars=r(3117);constc="nr@context:".concat(s.a),u=functione(t,r){varn={},s={},d={},l=!1;try{l=16===r.length&&(0,o.OP)(r).isolatedBacklog}catch(e){}varf={on:p,addEventListener:p,removeEventListener:function(e,t){varr=n[e];if(!r)return;for(vari=0;i{deletef.backlog[e]}))},isBuffering:function(e){return!!m()[s[e]]},debugId:r,backlog:l?{}:t&&"object"==typeoft.backlog?t.backlog:{},isolatedBacklog:l};returnObject.defineProperty(f,"aborted",{get:()=>{lete=f._aborted||!1;returne||(t&&(e=t.aborted),e)}}),f;functiong(e){returne&&einstanceofa?e:e?(0,i.X)(e,c,(()=>newa(c))):newa(c)}functionp(e,t){n[e]=h(e).concat(t)}functionh(e){returnn[e]||[]}functionv(t){returnd[t]=d[t]||e(f,t)}functionm(){returnf.backlog}}(void0,"globalEE"),d=(0,n.fP)();d.ee||(d.ee=u)},5546:(e,t,r)=>{"usestrict";r.d(t,{E:()=>n,p:()=>i});varn=r(8325).ee.get("handle");functioni(e,t,r,i,o){o?(o.buffer([e],i),o.emit(e,t,r)):(n.buffer([e],i),n.emit(e,t,r))}},4322:(e,t,r)=>{"usestrict";r.d(t,{X:()=>o});varn=r(5546);o.on=a;vari=o.handlers={};functiono(e,t,r,o){a(o||n.E,i,e,t,r)}functiona(e,t,r,i,o){o||(o="feature"),e||(e=n.E);vara=t[o]=t[o]||{};(a[r]=a[r]||[]).push([e,i])}},3239:(e,t,r)=>{"usestrict";r.d(t,{bP:()=>s,iz:()=>c,m$:()=>a});varn=r(385);leti=!1,o=!1;try{conste={getpassive(){returni=!0,!1},getsignal(){returno=!0,!1}};n._A.addEventListener("test",null,e),n._A.removeEventListener("test",null,e)}catch(e){}functiona(e,t){returni||o?{capture:!!e,passive:i,signal:t}:!!e}functions(e,t){letr=arguments.length>2&&void0!==arguments[2]&&arguments[2],n=arguments.length>3?arguments[3]:void0;window.addEventListener(e,t,a(r,n))}functionc(e,t){letr=arguments.length>2&&void0!==arguments[2]&&arguments[2],n=arguments.length>3?arguments[3]:void0;document.addEventListener(e,t,a(r,n))}},3117:(e,t,r)=>{"usestrict";r.d(t,{a:()=>n});constn=(0,r(4402).Rl)()},4402:(e,t,r)=>{"usestrict";r.d(t,{Rl:()=>a,ky:()=>s});varn=r(385);consti="xxxxxxxx-xxxx-4xxx-yxxx-xxxxxxxxxxxx";functiono(e,t){returne?15&e[t]:16*Math.random()|0}functiona(){conste=n._A?.crypto||n._A?.msCrypto;lett,r=0;returne&&e.getRandomValues&&(t=e.getRandomValues(newUint8Array(30))),i.split("").map((e=>"x"===e?o(t,r++).toString(16):"y"===e?(3&o()|8).toString(16):e)).join("")}functions(e){constt=n._A?.crypto||n._A?.msCrypto;letr,i=0;t&&t.getRandomValues&&(r=t.getRandomValues(newUint8Array(e)));consta=[];for(vars=0;s{"usestrict";r.d(t,{Bq:()=>n,Hb:()=>a,IK:()=>u,K4:()=>i,oD:()=>o,uT:()=>c,wO:()=>s});constn="NRBA",i="SESSION",o=144e5,a=18e5,s={STARTED:"session-started",PAUSE:"session-pause",RESET:"session-reset",RESUME:"session-resume",UPDATE:"session-update"},c={SAME_TAB:"same-tab",CROSS_TAB:"cross-tab"},u={OFF:0,FULL:1,ERROR:2}},7894:(e,t,r)=>{"usestrict";functionn(){returnMath.floor(performance.now())}r.d(t,{z:()=>n})},50:(e,t,r)=>{"usestrict";functionn(e,t){"function"==typeofconsole.warn&&(console.warn("NewRelic:".concat(e)),t&&console.warn(t))}r.d(t,{Z:()=>n})},2825:(e,t,r)=>{"usestrict";r.d(t,{N:()=>c,T:()=>s});varn=r(8325),i=r(385);consto="newrelic";consta=newSet,s={};functionc(e,t){constr=n.ee.get(t);s[t]??={},e&&"object"==typeofe&&(a.has(t)||(r.emit("rumresp",[e]),s[t]=e,a.add(t),function(){lete=arguments.length>0&&void0!==arguments[0]?arguments[0]:{};try{i._A.dispatchEvent(newCustomEvent(o,{detail:e}))}catch(e){}}({loaded:!0})))}},2210:(e,t,r)=>{"usestrict";r.d(t,{X:()=>i});varn=Object.prototype.hasOwnProperty;functioni(e,t,r){if(n.call(e,t))returne[t];vari=r();if(Object.defineProperty&&Object.keys)try{returnObject.defineProperty(e,t,{value:i,writable:!0,enumerable:!1}),i}catch(e){}returne[t]=i,i}},7872:(e,t,r)=>{"usestrict";functionn(e){vart=this;letr=arguments.length>1&&void0!==arguments[1]?arguments[1]:500,n=arguments.length>2&&void0!==arguments[2]?arguments[2]:{};consti=n?.leading||!1;leto;returnfunction(){for(varn=arguments.length,a=newArray(n),s=0;s{o=clearTimeout(o)}),r)),i||(clearTimeout(o),o=setTimeout((()=>{e.apply(t,a)}),r))}}functioni(e){vart=this;letr=!1;returnfunction(){if(!r){r=!0;for(varn=arguments.length,i=newArray(n),o=0;on,Z:()=>i})},1284:(e,t,r)=>{"usestrict";r.d(t,{D:()=>n});constn=(e,t)=>Object.entries(e||{}).map((e=>{let[r,n]=e;returnt(r,n)}))},4351:(e,t,r)=>{"usestrict";r.d(t,{P:()=>o});varn=r(8325);consti=()=>{conste=newWeakSet;return(t,r)=>{if("object"==typeofr&&null!==r){if(e.has(r))return;e.add(r)}returnr}};functiono(e){try{returnJSON.stringify(e,i())}catch(e){try{n.ee.emit("internal-error",[e])}catch(e){}}}},3960:(e,t,r)=>{"usestrict";r.d(t,{KB:()=>a,b2:()=>o});varn=r(3239);functioni(){return"undefined"==typeofdocument||"complete"===document.readyState}functiono(e,t){if(i())returne();(0,n.bP)("load",e,t)}functiona(e){if(i())returne();(0,n.iz)("DOMContentLoaded",e)}},8632:(e,t,r)=>{"usestrict";r.d(t,{EZ:()=>d,ce:()=>o,ek:()=>u,fP:()=>a,gG:()=>l,h5:()=>c,mF:()=>s});varn=r(385),i=r(7894);consto={beacon:"bam.nr-data.net",errorBeacon:"bam.nr-data.net"};functiona(){returnn._A.NREUM||(n._A.NREUM={}),void0===n._A.newrelic&&(n._A.newrelic=n._A.NREUM),n._A.NREUM}functions(){lete=a();returne.o||(e.o={ST:n._A.setTimeout,SI:n._A.setImmediate,CT:n._A.clearTimeout,XHR:n._A.XML,REQ:n._A.Request,EV:n._A.Event,PR:n._A.Promise,MO:n._A.MutationObserver,FETCH:n._A.fetch}),e}functionc(e,t){letr=a();r.initializedents??={},t.initializedAt={ms:(0,i.z)(),date:newDate},r.initializedents[e]=t}functionu(e){lett=a();returnt.initializedents?.[e]}functiond(e,t){a()[e]=t}functionl(){returnfunction(){lete=a();constt=e.info||{};e.info={beacon:o.beacon,errorBeacon:o.errorBeacon,...t}}(),function(){lete=a();constt=e.init||{};e.init={...t}}(),s(),function(){lete=a();constt=e.loader_config||{};e.loader_config={...t}}(),a()}},7956:(e,t,r)=>{"usestrict";r.d(t,{N:()=>i});varn=r(3239);functioni(e){lett=arguments.length>1&&void0!==arguments[1]&&arguments[1],r=arguments.length>2?arguments[2]:void0,i=arguments.length>3?arguments[3]:void0;(0,n.iz)("visibilitychange",(function(){if(t)returnvoid("hidden"===document.visibilityState&&e());e(document.visibilityState)}),r,i)}},3081:(e,t,r)=>{"usestrict";r.d(t,{gF:()=>o,mY:()=>i,t9:()=>n,vz:()=>s,xS:()=>a});constn=r(3325).D.metrics,i="sm",o="cm",a="storeSupportabilityMetrics",s="storeEventMetrics"},7633:(e,t,r)=>{"usestrict";r.d(t,{t:()=>n});constn=r(3325).D.peViewEvent},9251:(e,t,r)=>{"usestrict";r.d(t,{t:()=>n});constn=r(3325).D.peViewTiming},7144:(e,t,r)=>{"usestrict";r.d(t,{Ef:()=>i});varn=r(7056);r(3325).D.sessionReplay;consti={RECORD:"recordReplay",PAUSE:"pauseReplay",REPLAY_RUNNING:"replayRunning",ERROR_DURING_REPLAY:"errorDuringReplay"};n.IK.ERROR,n.IK.FULL,n.IK.OFF},5938:(e,t,r)=>{"usestrict";r.d(t,{W:()=>i});varn=r(8325);classi{constructor(e,t,r){this.entIdentifier=e,this.gregator=t,this.ee=n.ee.get(e),this.featureName=r,this.blocked=!1}}},2758:(e,t,r)=>{"usestrict";r.d(t,{j:()=>E});varn=r(3325),i=r(234),o=r(5546),a=r(8325),s=r(8e3),c=r(3960),u=r(385),d=r(50),l=r(3081),f=r(8632),g=r(7144);constp=["setErrorHandler","finished","addToTrace","addRelease","addPeAction","setCurrentRouteName","setPeViewName","setCustomAttribute","interaction","noticeError","setUserId","setApplicationVersion","start",g.Ef.RECORD,g.Ef.PAUSE],h=["setErrorHandler","finished","addToTrace","addRelease"];varv=r(7894),m=r(7056);functionb(){conste=(0,f.gG)();p.forEach((t=>{e[t]=function(){for(varr=arguments.length,n=newArray(r),i=0;i1?r-1:0),i=1;i{e.exposed&&e.api[t]&&o.push(e.api[t](...n))})),o.length>1?o:o[0]}(t,...n)}}))}consty={};varA=r(2825);constw=e=>{constt=e.startsWith("http");e+="/",r.p=t?e:""+e};let_=!1;functionE(e){lett=arguments.length>1&&void0!==arguments[1]?arguments[1]:{},p=arguments.length>2?arguments[2]:void0,E=arguments.length>3?arguments[3]:void0,{init:x,info:D,loader_config:S,runtime:R={loaderType:p},exposed:k=!0}=t;constN=(0,f.gG)();D||(x=N.init,D=N.info,S=N.loader_config),(0,i.Dg)(e.entIdentifier,x||{}),(0,i.GE)(e.entIdentifier,S||{}),D.jsAttributes??={},u.v6&&(D.jsAttributes.isWorker=!0),(0,i.CX)(e.entIdentifier,D);constP=(0,i.P_)(e.entIdentifier),j=[D.beacon,D.errorBeacon];_||(P.proxy.assets&&(w(P.proxy.assets),j.push(P.proxy.assets)),P.proxy.beacon&&j.push(P.proxy.beacon),b(),(0,f.EZ)("activatedFeatures",A.T),e.runSoftNOverSpa&&=!0===P.soft_nigations.enabled&&P.feature_fls.includes("soft_n")),R.denyList=[...P.ajax.deny_list||[],...P.ajax.block_internal?j:[]],R.ptid=e.entIdentifier,(0,i.sU)(e.entIdentifier,R),void0===e.api&&(e.api=function(e,t){letf=arguments.length>2&&void0!==arguments[2]&&arguments[2];t||(0,s.RP)(e,"api");constp={};varb=a.ee.get(e),A=b.get("tracer");y[e]=m.IK.OFF,b.on(g.Ef.REPLAY_RUNNING,(t=>{y[e]=t}));varw="api-",_=w+"ixn-";functionE(t,r,n,o){consta=(0,i.C5)(e);returnnull===r?deletea.jsAttributes[t]:(0,i.CX)(e,{...a,jsAttributes:{...a.jsAttributes,[t]:r}}),S(w,n,!0,o||null===r?"session":void0)(t,r)}functionx(){}h.forEach((e=>{p[e]=S(w,e,!0,"api")})),p.addPeAction=S(w,"addPeAction",!0,n.D.peAction),p.setPeViewName=function(t,r){if("string"==typeoft)return"/"!==t.charAt(0)&&(t="/"+t),(0,i.OP)(e).customTransaction=(r||"httpcustom.transaction")+t,S(w,"setPeViewName",!0)()},p.setCustomAttribute=function(e,t){letr=arguments.length>2&&void0!==arguments[2]&&arguments[2];if("string"==typeofe){if(["string","number","boolean"].includes(typeoft)||null===t)returnE(e,t,"setCustomAttribute",r);(0,d.Z)("FailedtoexecutesetCustomAttribute.\nNon-nullvaluemustbeastring,numberorbooleantype,butatypeofwasprovided."))}else(0,d.Z)("FailedtoexecutesetCustomAttribute.\nNamemustbeastringtype,butatypeofwasprovided."))},p.setUserId=function(e){if("string"==typeofe||null===e)returnE("enduser.id",e,"setUserId",!0);(0,d.Z)("FailedtoexecutesetUserId.\nNon-nullvaluemustbeastringtype,butatypeofwasprovided."))},p.setApplicationVersion=function(e){if("string"==typeofe||null===e)returnE("application.version",e,"setApplicationVersion",!1);(0,d.Z)("FailedtoexecutesetApplicationVersion.Expected,butgot."))},p.start=()=>{try{(0,o.p)(l.xS,["API/start/called"],void0,n.D.metrics,b),b.emit("manual-start-all")}catch(e){(0,d.Z)("Anunexpectedissueoccurred",e)}},p[g.Ef.RECORD]=function(){(0,o.p)(l.xS,["API/recordReplay/called"],voidComo construir um site em 2022: Guia Passo a Passo Completo0,n.D.metrics,b),(0,o.p)(g.Ef.RECORD,[],void0,n.D.sessionReplay,b)},p[g.Ef.PAUSE]=function(){(0,o.p)(l.xS,["API/pauseReplay/called"],void0,n.D.metrics,b),(0,o.p)(g.Ef.PAUSE,[],void0,n.D.sessionReplay,b)},p.interaction=function(e){return(newx).get("object"==typeofe?e:{})};constD=x.prototype={createTracer:function(e,t){varr={},i=this,a="function"==typeoft;return(0,o.p)(l.xS,["API/createTracer/called"],void0,n.D.metrics,b),f||(0,o.p)(_+"tracer",[(0,v.z)(),e,r],i,n.D.spa,b),function(){if(A.emit((a?"":"no-")+"fn-start",[(0,v.z)(),i,a],r),a)try{returnt.apply(this,arguments)}catch(e){constt="string"==typeofe?newError(e):e;throwA.emit("fn-err",[arguments,this,t],r),t}finally{A.emit("fn-end",[(0,v.z)()],r)}}}};functionS(e,t,r,i){returnfunction(){return(0,o.p)(l.xS,["API/"+t+"/called"],void0,n.D.metrics,b),i&&(0,o.p)(e+t,[(0,v.z)(),...arguments],r?null:this,i,b),r?void0:this}}functionR(){r.e(75).then(r.bind(r,7438)).then((t=>{let{setAPI:r}=t;r(e),(0,s.LP)(e,"api")})).catch((e=>{(0,d.Z)("DownloadingruntimeAPIsfailed...",e),b.abort()}))}return["actionText","setName","setAttribute","se","ignore","onEnd","getContext","end","get"].forEach((e=>{D[e]=S(_,e,void0,f?n.D.softN:n.D.spa)})),p.setCurrentRouteName=f?S(_,"routeName",void0,n.D.softN):S(w,"routeName",!0,n.D.spa),p.noticeError=function(t,r){"string"==typeoft&&(t=newError(t)),(0,o.p)(l.xS,["API/noticeError/called"],void0,n.D.metrics,b),(0,o.p)("err",[t,(0,v.z)(),!1,r,!!y[e]],void0,n.D.jserrors,b)},u.il?(0,c.b2)((()=>R()),!0):R(),p}(e.entIdentifier,E,e.runSoftNOverSpa)),void0===e.exposed&&(e.exposed=k),_=!0}},8993:(e,t,r)=>{r.nc=(()=>{try{returndocument?.currentScript?.nonce}catch(e){}return""})()},3325:(e,t,r)=>{"usestrict";r.d(t,{D:()=>n,p:()=>i});constn={ajax:"ajax",jserrors:"jserrors",metrics:"metrics",peAction:"pe_action",peViewEvent:"pe_view_event",peViewTiming:"pe_view_timing",sessionReplay:"session_replay",sessionTrace:"session_trace",softN:"soft_nigations",spa:"spa"},i={[n.peViewEvent]:1,[n.peViewTiming]:2,[n.metrics]:3,[n.jserrors]:4,[n.ajax]:5,[n.sessionTrace]:6,[n.peAction]:7,[n.spa]:8,[n.softN]:9,[n.sessionReplay]:10}}},n={};functioni(e){vart=n[e];if(void0!==t)returnt.exports;varo=n[e]={exports:{}};returnr[e](o,o.exports,i),o.exports}i.m=r,i.d=(e,t)=>{for(varrint)i.o(t,r)&&!i.o(e,r)&&Object.defineProperty(e,r,{enumerable:!0,get:t[r]})},i.f={},i.e=e=>Promise.all(Object.keys(i.f).reduce(((t,r)=>(i.f[r](e,t),t)),[])),i.u=e=>"nr-rum-1.260.1.min.js",i.o=(e,t)=>Object.prototype.hasOwnProperty.call(e,t),e={},t="NRBA-1.260.1.PROD:",i.l=(r,n,o,a)=>{if(e[r])e[r].push(n);else{vars,c;if(void0!==o)for(varu=document.getElementsByTName("script"),d=0;d{s.onerror=s.onload=null,clearTimeout(p);vari=e[r];if(deletee[r],s.parentNode&&s.parentNode.removeChild(s),i&&i.forEach((e=>e(n))),t)returnt(n)},p=setTimeout(g.bind(null,void0,{type:"timeout",target:s}),12e4);s.onerror=g.bind(null,s.onerror),s.onload=g.bind(null,s.onload),c&&document.head.appendChild(s)}},i.r=e=>{"undefined"!=typeofSymbol&&Symbol.toStringT&&Object.defineProperty(e,Symbol.toStringT,{value:"Module"}),Object.defineProperty(e,"__esModule",{value:!0})},i.p="js-ent.newrelic.com/",(()=>{vare={50:0,832:0};i.f.j=(t,r)=>{varn=i.o(e,t)?e[t]:void0;if(0!==n)if(n)r.push(n[2]);else{varo=newPromise(((r,i)=>n=e[t]=[r,i]));r.push(n[2]=o);vara=i.p+i.u(t),s=newError;i.l(a,(r=>{if(i.o(e,t)&&(0!==(n=e[t])&&(e[t]=void0),n)){varo=r&&("load"===r.type?"missing":r.type),a=r&&r.target&&r.target.src;s.messe="Loadingchunk"+t+"failed.\n("+o+":"+a+")",s.name="ChunkLoadError",s.type=o,s.request=a,n[1](s)}}),"chunk-"+t,t)}};vart=(t,r)=>{varn,o,[a,s,c]=r,u=0;if(a.some((t=>0!==e[t]))){for(nins)i.o(s,n)&&(i.m[n]=s[n]);if(c)c(i)}for(t&&t(r);u{"usestrict";i(8993);vare=i(50),t=i(7144),r=i(4402),n=i(8325);classo{entIdentifier;constructor(){lete=arguments.length>0&&void0!==arguments[0]?arguments[0]:(0,r.ky)(16);this.entIdentifier=e,this.ee=n.ee.get(e)}#e(t){for(varr=arguments.length,n=newArray(r>1?r-1:0),i=1;i{t[r]=function(e,t){return!0===(0,s.Mt)(t,"".concat(e,".enabled"))}(r,e)})),t}vard=i(2758);varl=i(8e3),f=i(5938),g=i(3960),p=i(385);consth=e=>p.il&&!0===(0,s.Mt)(e,"privacy.cookies_enabled");functionv(e){return!!s.Yu.MO&&h(e)&&!0===(0,s.Mt)(e,"session_trace.enabled")}varm=i(7872);classbextendsf.W{constructor(e,t,r){letn=!(arguments.length>3&&void0!==arguments[3])||arguments[3];super(e,t,r),this.auto=n,this.abortHandler=void0,this.featgregate=void0,this.ongregateImported=void0,!1===(0,s.Mt)(this.entIdentifier,"".concat(this.featureName,".autoStart"))&&(this.auto=!1),this.auto?(0,l.RP)(e,r):this.ee.on("manual-start-all",(0,m.Z)((()=>{(0,l.RP)(this.entIdentifier,this.featureName),this.auto=!0,this.importgregator()})))}importgregator(){lett,r=arguments.length>0&&void0!==arguments[0]?arguments[0]:{};if(this.featgregate||!this.auto)return;this.ongregateImported=newPromise((e=>{t=e}));constn=async()=>{letn;try{if(h(this.entIdentifier)){const{setupentSession:e}=awaiti.e(75).then(i.bind(i,7920));n=e(this.entIdentifier)}}catch(t){(0,e.Z)("Aproblemoccurredwhenstartingupsessionmaner.Thispewillnotstartorextendanysession.",t),this.featureName===a.D.sessionReplay&&this.abortHandler?.()}try{if(!this.#t(this.featureName,n))return(0,l.LP)(this.entIdentifier,this.featureName),voidt(!1);const{lazyFeatureLoader:e}=awaiti.e(75).then(i.bind(i,8582)),{gregate:o}=awaite(this.featureName,"gregate");this.featgregate=newo(this.entIdentifier,this.gregator,r),t(!0)}catch(r){(0,e.Z)("Downloadingandinitializing".concat(this.featureName,"failed..."),r),this.abortHandler?.(),(0,l.LP)(this.entIdentifier,this.featureName,!0),t(!1),this.ee&&this.ee.abort()}};p.il?(0,g.b2)((()=>n()),!0):n()}#t(e,t){returne!==a.D.sessionReplay||(r=this.entIdentifier,n=t,!(!v(r)||!n?.isNew&&!n?.state.sessionReplayMode));varr,n}}vary=i(7633);classAextendsb{staticfeatureName=y.t;constructor(e,t){letr=!(arguments.length>2&&void0!==arguments[2])||arguments[2];super(e,t,y.t,r),this.importgregator()}}varw=i(1117),_=i(1284);classEextendsw.w{constructor(e){super(e),this.gregatedData={}}store(e,t,r,n,i){varo=this.getBucket(e,t,r,i);returno.metrics=function(e,t){t||(t={count:0});returnt.count+=1,(0,_.D)(e,(function(e,r){t[e]=x(r,t[e])})),t}(n,o.metrics),o}merge(e,t,r,n,i){varo=this.getBucket(e,t,n,i);if(o.metrics){vara=o.metrics;a.count+=r.count,(0,_.D)(r,(function(e,t){if("count"!==e){varn=a[e],i=r[e];i&&!i.c?a[e]=x(i.t,n):a[e]=function(e,t){if(!t)returne;t.c||(t=D(t.t));returnt.min=Math.min(e.min,t.min),t.max=Math.max(e.max,t.max),t.t+=e.t,t.sos+=e.sos,t.c+=e.c,t}(i,a[e])}}))}elseo.metrics=r}storeMetric(e,t,r,n){vari=this.getBucket(e,t,r);returni.stats=x(n,i.stats),i}getBucket(e,t,r,n){this.gregatedData[e]||(this.gregatedData[e]={});vari=this.gregatedData[e][t];returni||(i=this.gregatedData[e][t]={params:r||{}},n&&(i.custom=n)),i}get(e,t){returnt?this.gregatedData[e]&&this.gregatedData[e][t]:this.gregatedData[e]}take(e){for(vart={},r="",n=!1,i=0;it.max&&(t.max=e),e2&&void0!==arguments[2])||arguments[2];super(e,t,j.t,r),p.il&&((0,N.N)((()=>(0,k.p)("docHidden",[(0,T.z)()],void0,j.t,this.ee)),!0),(0,P.bP)("pehide",(()=>(0,k.p)("winPehide",[(0,T.z)()],void0,j.t,this.ee))),this.importgregator())}}varO=i(3081);classMextendsb{staticfeatureName=O.t9;constructor(e,t){letr=!(arguments.length>2&&void0!==arguments[2])||arguments[2];super(e,t,O.t9,r),this.importgregator()}}newclassextendso{constructor(t,r){super(r),p._A?(this.sharedgregator=newE({entIdentifier:this.entIdentifier}),this.features={},(0,S.h5)(this.entIdentifier,this),this.desiredFeatures=newSet(t.features||[]),this.desiredFeatures.add(A),this.runSoftNOverSpa=[...this.desiredFeatures].some((e=>e.featureName===a.D.softN)),(0,d.j)(this,t,t.loaderType||"ent"),this.run()):(0,e.Z)("Failedtoinitializetheent.Couldnotdeterminetheruntimeenvironment.")}getconfig(){return{info:this.info,init:this.init,loader_config:this.loader_config,runtime:this.runtime}}run(){try{constt=u(this.entIdentifier),r=[...this.desiredFeatures];r.sort(((e,t)=>a.p[e.featureName]-a.p[t.featureName])),r.forEach((r=>{if(!t[r.featureName]&&r.featureName!==a.D.peViewEvent)return;if(this.runSoftNOverSpa&&r.featureName===a.D.spa)return;if(!this.runSoftNOverSpa&&r.featureName===a.D.softN)return;constn=function(e){switch(e){casea.D.ajax:return[a.D.jserrors];casea.D.sessionTrace:return[a.D.ajax,a.D.peViewEvent];casea.D.sessionReplay:return[a.D.sessionTrace];casea.D.peViewTiming:return[a.D.peViewEvent];default:return[]}}(r.featureName);n.every((e=>einthis.features))||(0,e.Z)("".concat(r.featureName,"isenabledbutoneormoredependentfeatureshasnotbeeninitialized(").concat((0,R.P)(n),").Thismaycauseunintendedconsequencesormissingdata...")),this.features[r.featureName]=newr(this.entIdentifier,this.sharedgregator)}))}catch(t){(0,e.Z)("Failedtoinitializeallenabledinstrumentclasses(entaborted)-",t);for(consteinthis.features)this.features[e].abortHandler?.();constr=(0,S.fP)();deleter.initializedents[this.entIdentifier]?.api,deleter.initializedents[this.entIdentifier]?.features,deletethis.sharedgregator;returnr.ee.get(this.entIdentifier).abort(),!1}}}({features:[A,I,M],loaderType:"lite"})})()})();HowtoBuildaWebsitein2024:CompleteStep-by-StepGuidebody{--wp--preset--color--black:#;--wp--preset--color--cyan-bluish-gray:#abb8c3;--wp--preset--color--white:#ffffff;--wp--preset--color--pale-pink:#f78da7;--wp--preset--color--vivid-red:#cf2e2e;--wp--preset--color--luminous-vivid-orange:#ff6900;--wp--preset--color--luminous-vivid-amber:#fcb900;--wp--preset--color--light-green-cyan:#7bdcb5;--wp--preset--color--vivid-green-cyan:#00d084;--wp--preset--color--pale-cyan-blue:#8ed1fc;--wp--preset--color--vivid-cyan-blue:#0693e3;--wp--preset--color--vivid-purple:#9b51e0;--wp--preset--gradient--vivid-cyan-blue-to-vivid-purple:linear-gradient(135deg,rgba(6,147,227,1)0%,rgb(155,81,224)100%);--wp--preset--gradient--light-green-cyan-to-vivid-green-cyan:linear-gradient(135deg,rgb(122,220,180)0%,rgb(0,208,130)100%);--wp--preset--gradient--luminous-vivid-amber-to-luminous-vivid-orange:linear-gradient(135deg,rgba(252,185,0,1)0%,rgba(255,105,0,1)100%);--wp--preset--gradient--luminous-vivid-orange-to-vivid-red:linear-gradient(135deg,rgba(255,105,0,1)0%,rgb(207,46,46)100%);--wp--preset--gradient--very-light-gray-to-cyan-bluish-gray:linear-gradient(135deg,rgb(238,238,238)0%,rgb(169,184,195)100%);--wp--preset--gradient--cool-to-warm-spectrum:linear-gradient(135deg,rgb(74,234,220)0%,rgb(151,120,209)20%,rgb(207,42,186)40%,rgb(238,44,130)60%,rgb(251,105,98)80%,rgb(254,248,76)100%);--wp--preset--gradient--blush-light-purple:linear-gradient(135deg,rgb(255,206,236)0%,rgb(152,150,240)100%);--wp--preset--gradient--blush-bordeaux:linear-gradient(135deg,rgb(254,205,165)0%,rgb(254,45,45)50%,rgb(107,0,62)100%);--wp--preset--gradient--luminous-dusk:linear-gradient(135deg,rgb(255,203,112)0%,rgb(199,81,192)50%,rgb(65,88,208)100%);--wp--preset--gradient--pale-ocean:linear-gradient(135deg,rgb(255,245,203)0%,rgb(182,227,212)50%,rgb(51,167,181)100%);--wp--preset--gradient--electric-grass:linear-gradient(135deg,rgb(202,248,128)0%,rgb(113,206,126)100%);--wp--preset--gradient--midComo construir um site em 2022: Guia Passo a Passo Completonight:linear-gradient(135deg,rgb(2,3,129)0%,rgb(40,116,252)100%);--wp--preset--duotone--dark-grayscale:url('#wp-duotone-dark-grayscale');--wp--preset--duotone--grayscale:url('#wp-duotone-grayscale');--wp--preset--duotone--purple-yellow:url('#wp-duotone-purple-yellow');--wp--preset--duotone--blue-red:url('#wp-duotone-blue-red');--wp--preset--duotone--midnight:url('#wp-duotone-midnight');--wp--preset--duotone--menta-yellow:url('#wp-duotone-menta-yellow');--wp--preset--duotone--purple-green:url('#wp-duotone-purple-green');--wp--preset--duotone--blue-orange:url('#wp-duotone-blue-orange');--wp--preset--font-size--small:13px;--wp--preset--font-size--medium:20px;--wp--preset--font-size--large:36px;--wp--preset--font-size--x-large:42px;--wp--preset--spacing--20:0.44rem;--wp--preset--spacing--30:0.67rem;--wp--preset--spacing--40:1rem;--wp--preset--spacing--50:1.5rem;--wp--preset--spacing--60:2.25rem;--wp--preset--spacing--70:3.38rem;--wp--preset--spacing--80:5.06rem;}:where(.is-layout-flex){gap:0.5em;}body.is-layout-flow>.alignleft{float:left;margin-inline-start:0;margin-inline-end:2em;}body.is-layout-flow>.alignright{float:right;margin-inline-start:2em;margin-inline-end:0;}body.is-layout-flow>.aligncenter{margin-left:auto!important;margin-right:auto!important;}body.is-layout-constrained>.alignleft{float:left;margin-inline-start:0;margin-inline-end:2em;}body.is-layout-constrained>.alignright{float:right;margin-inline-start:2em;margin-inline-end:0;}body.is-layout-constrained>.aligncenter{margin-left:auto!important;margin-right:auto!important;}body.is-layout-constrained>:where(:not(.alignleft):not(.alignright):not(.alignfull)){max-width:var(--wp--style--global--content-size);margin-left:auto!important;margin-right:auto!important;}body.is-layout-constrained>.alignwide{max-width:var(--wp--style--global--wide-size);}body.is-layout-flex{display:flex;}body.is-layout-flex{flex-wrap:wrap;align-items:center;}body.is-layout-flex>*{margin:0;}:where(.wp-block-columns.is-layout-flex){gap:2em;}.has-black-color{color:var(--wp--preset--color--black)!important;}.has-cyan-bluish-gray-color{color:var(--wp--preset--color--cyan-bluish-gray)!important;}.has-white-color{color:var(--wp--preset--color--white)!important;}.has-pale-pink-color{color:var(--wp--preset--color--pale-pink)!important;}.has-vivid-red-color{color:var(--wp--preset--color--vivid-red)!important;}.has-luminous-vivid-orange-color{color:var(--wp--preset--color--luminous-vivid-orange)!important;}.has-luminous-vivid-amber-color{color:var(--wp--preset--color--luminous-vivid-amber)!important;}.has-light-green-cyan-color{color:var(--wp--preset--color--light-green-cyan)!important;}.has-vivid-green-cyan-color{color:var(--wp--preset--color--vivid-green-cyan)!important;}.has-pale-cyan-blue-color{color:var(--wp--preset--color--pale-cyan-blue)!important;}.has-vivid-cyan-blue-color{color:var(--wp--preset--color--vivid-cyan-blue)!important;}.has-vivid-purple-color{color:var(--wp--preset--color--vivid-purple)!important;}.has-black-background-color{background-color:var(--wp--preset--color--black)!important;}.has-cyan-bluish-gray-background-color{background-color:var(--wp--preset--color--cyan-bluish-gray)!important;}.has-white-background-color{background-color:var(--wp--preset--color--white)!important;}.has-pale-pink-background-color{background-color:var(--wp--preset--color--pale-pink)!important;}.has-vivid-red-background-color{background-color:var(--wp--preset--color--vivid-red)!important;}.has-luminous-vivid-orange-background-color{background-color:var(--wp--preset--color--luminous-vivid-orange)!important;}.has-luminous-vivid-amber-background-color{background-color:var(--wp--preset--color--luminous-vivid-amber)!important;}.has-light-green-cyan-background-color{background-color:var(--wp--preset--color--light-green-cyan)!important;}.has-vivid-green-cyan-background-color{background-color:var(--wp--preset--color--vivid-green-cyan)!important;}.has-pale-cyan-blue-background-color{background-color:var(--wp--preset--color--pale-cyan-blue)!important;}.has-vivid-cyan-blue-background-color{background-color:var(--wp--preset--color--vivid-cyan-blue)!important;}.has-vivid-purple-background-color{background-color:var(--wp--preset--color--vivid-purple)!important;}.has-black-border-color{border-color:var(--wp--preset--color--black)!important;}.has-cyan-bluish-gray-border-color{border-color:var(--wp--preset--color--cyan-bluish-gray)!important;}.has-white-border-color{border-color:var(--wp--preset--color--white)!important;}.has-pale-pink-border-color{border-color:var(--wp--preset--color--pale-pink)!important;}.has-vivid-red-border-color{border-color:var(--wp--preset--color--vivid-red)!important;}.has-luminous-vivid-orange-border-color{border-color:var(--wp--preset--color--luminous-vivid-orange)!important;}.has-luminous-vivid-amber-border-color{border-color:var(--wp--preset--color--luminous-vivid-amber)!important;}.has-light-green-cyan-border-color{border-color:var(--wp--preset--color--light-green-cyan)!important;}.has-vivid-green-cyan-border-color{border-color:var(--wp--preset--color--vivid-green-cyan)!important;}.has-pale-cyan-blue-border-color{border-color:var(--wp--preset--color--pale-cyan-blue)!important;}.has-vivid-cyan-blue-border-color{border-color:var(--wp--preset--color--vivid-cyan-blue)!important;}.has-vivid-purple-border-color{border-color:var(--wp--preset--color--vivid-purple)!important;}.has-vivid-cyan-blue-to-vivid-purple-gradient-background{background:var(--wp--preset--gradient--vivid-cyan-blue-to-vivid-purple)!important;}.has-light-green-cyan-to-vivid-green-cyan-gradient-background{background:var(--wp--preset--gradient--light-green-cyan-to-vivid-green-cyan)!important;}.has-luminous-vivid-amber-to-luminous-vivid-orange-gradient-background{background:var(--wp--preset--gradient--luminous-vivid-amber-to-luminous-vivid-orange)!important;}.has-luminous-vivid-orange-to-vivid-red-gradient-background{background:var(--wp--preset--gradient--luminous-vivid-orange-to-vivid-red)!important;}.has-very-light-gray-to-cyan-bluish-gray-gradient-background{background:var(--wp--preset--gradient--very-light-gray-to-cyan-bluish-gray)!important;}.has-cool-to-warm-spectrum-gradient-background{background:var(--wp--preset--gradient--cool-to-warm-spectrum)!important;}.has-blush-light-purple-gradient-background{background:var(--wp--preset--gradient--blush-light-purple)!important;}.has-blush-bordeaux-gradient-background{background:var(--wp--preset--gradient--blush-bordeaux)!important;}.has-luminous-dusk-gradient-background{background:var(--wp--preset--gradient--luminous-dusk)!important;}.has-pale-ocean-gradient-background{background:var(--wp--preset--gradient--pale-ocean)!important;}.has-electric-grass-gradient-background{background:var(--wp--preset--gradient--electric-grass)!important;}.has-midnight-gradient-background{background:var(--wp--preset--gradient--midnight)!important;}.has-small-font-size{font-size:var(--wp--preset--font-size--small)!important;}.has-medium-font-size{font-size:var(--wp--preset--font-size--medium)!important;}.has-large-font-size{font-size:var(--wp--preset--font-size--large)!important;}.has-x-large-font-size{font-size:var(--wp--preset--font-size--x-large)!important;}.wp-block-nigationa:where(:not(.wp-element-button)){color:inherit;}:where(.wp-block-columns.is-layout-flex){gap:2em;}.wp-block-pullquote{font-size:1.5em;line-height:1.6;}window.dataLayer=window.dataLayer||[];functiongt(){dataLayer.push(arguments);window.googleEvents=window.googleEvents||[];window.googleEvents.push(arguments);}constEU_codes=["AT","BE","BG","HR","CY","CZ","DK","EE","FI","FR","DE","GR","HU","IE","IT","LV","LT","LU","MT","NL","PL","PT","RO","SK","SI","ES","SE"];constcountryAttribute=document.querySelector("html").getAttribute("country");window.isEU=EU_codes.includes(countryAttribute);if(window.isEU){letoneTrustScriptElement=document.createElement('script');oneTrustScriptElement.type='text/jascript';oneTrustScriptElement.textContent='functionOptanonWrapper(){}';document.head.appendChild(oneTrustScriptElement);letoneTrustID='018e0dcf-b998-7943-ae78-60ed514';letoneTrustScript=document.createElement('script');oneTrustScript.type='text/jascript';oneTrustScript.src='cdn.cookielaw.org/scripttemplates/otSDKStub.js';oneTrustScript.setAttribute('data-domain-script',oneTrustID);oneTrustScript.setAttribute('data-document-langue',true);document.head.appendChild(oneTrustScript);gt('consent','default',{'ad_store':'denied','ad_user_data':'denied','ad_personalization':'denied','analytics_store':'granted','wait_for_update':500});}gt('js',newDate());gt('config','G-7L0W5XYKZE',{'user_id':userGUID});if(typeofvarid!=='undefined'&&typeofexpid!=='undefined'&&!!expid){gt('config','G-7L0W5XYKZE',{'expId':[{'id':expid}]});gt('config','G-7L0W5XYKZE',{'expVar':[{'id':varid}]});}Werankvendorsbasedonrigoroustestingandresearch,butalsotakeintoaccountyourfeedbackandourcommercialreementswithproviders.Thispecontainsaffiliatelinks.AdvertisingDisclosureUS$Reviewschoosebycategory WebsiteBuilders WebHosting CreditCardProcessing LLCServices ProjectManementSoftware LogoDesignServices FreelanceWebsites LandingPeCreators FormBuilders SocialMediaTools CloudStore EmailMarketingServices WebsiteBuilders WebHosting CreditCardProcessing LLCServices ProjectManementSoftware LogoDesignServices FreelanceWebsites LandingPeCreators FormBuilders SocialMediaTools CloudStore EmailMarketingServiceschoosebytopprovidersWebsiteBuildersWixSITE123SquarespaceWebadorIONOSWebsiteBuilderViewBestWebHostingHostingerIONOSInterServerNexcessKinstaViewBestCreditCardProcessingLeadersMerchantServicesPaysafeSquarePaymentsStaxPaymentDepotViewBestLLCServicesZenBusinessTailorBrandsLLCLegalZoomNorthwestRegisteredentBizee(Incfile)ViewBestProjectManementSoftwaremonday.comClickUpSmartsheetJiraTeamworkViewBestLogoDesignServicesFiverrLogoDesignWixLogoMakerLookaDesignCrowd99designsViewBestCoupons99+WebsiteBuildersWix(4)SITE123(4)Squarespace(4)Webador(4)IONOSWebsiteBuilder(4)ViewBestWebHostingHostinger(4)IONOS(2)InterServer(4)Nexcess(4)Kinsta(1)ViewBestLogoDesignServicesFiverrLogoDesign(3)WixLogoMaker(2)Looka(3)DesignCrowd(3)99designs(1)ViewBestEmailMarketingServicesBrevo(formerlySendinblue)(3)AWeber(2)Omnisend(3)Mailchimp(1)GetResponse(5)ViewBestToolsPopulartoolsCompressPNG/JPGFreeQRCodeGeneratorShareLinkCreatorDomainExpirationCheckerSiteDownorNotMultipleURLOpenerSeeAllToolsWebmastertoolsRobots.txtCheckerXMLSitemapValidatorFiconGeneratorResponsiveCheckerSSLCheckerDomainExpirationCheckerPerformancetoolsGzipCompressionRedirectCheckerCompressPNG/JPGSiteDownorNotDummyImeGeneratorA/BTestCalculatorFreeQRCodeGeneratorOperationaltoolsMyscreenresolutionMultipleURLOpenerShareLinkCreatorJS&CSSMinifierLoremIpsumGeneratorAMPValidatorBlogNewsUS$Topcurrencies>€EuroUS$U.S.dollar£PoundsterlingAU$AustraliandollarAllcurrenciesAR$ArgentinepesoAU$AustraliandollarR$BrazilianrealBGNBulgarianlevCA$CanadiandollarCL$ChileanpesoCNYChineseyuanCOL$ColombianpesoKčCzechkorunaDKKDanishkroneE£Egyptianpound€EuroHK$HongKongDollarHRKCroatiankunaHUFHungarianforintRs.IndianrupeeRpIndonesianrupiah₪Israelinewsheqel¥JapaneseyenJODJordaniandinarKRWKoreanwonMex$MexicanpesoNT$NewTaiwanDollarNZ$NewZealanddollarNOKNorwegiankronezłPolishzloty£PoundsterlingleiRomaniannewleuRUBRussianRubleSARSaudiArabianriyalZARSouthAfricanrandS$SingaporedollarSEKSwedishkronaCHFSwissfrancTHBThaibahtTLTurkishliraAEDU.A.E.dirhamUS$U.S.dollarUAHUkraineHryvniaVNDVietnameseDongSelectyourlangueEnglishDanskDeutschEspañolFrançaisIndonesiaItalianoMyarNederlandsNorskbokmålPolskiPortuguêsRomânăSuomiSvenskaViệtnamTürkçeČeskyΕλληνικαРусскийУкраїнськаБългарскиไทย語简体中文한국어עבריתالعربيةHrvatskiWerankvendorsbasedonrigoroustestingandresearch,butalsotakeintoaccountyourfeedbackandourcommercialreementswithproviders.Thispecontainsaffiliatelinks.AdvertisingDisclosure HowtoBuildaWebsitein2024:CompleteStep-by-StepGuide AndrésGánemMarch01,2024March01,2024 InsidethisArticleOption1:UsingaWebsiteBuilderWebsiteBuilderComparisonTableWebsiteBuilderFAQOption2:UsingWordPressWordPressFAQTakingYourWebsitetotheNextLevelFinalWordsGettingyourwebsiteonlinecanseemlikeadauntingtask–butifyoufollowtherightsteps,itcanbeeasierthanyoumightthink.Youdon’tneedtobeawebdesignexpertwithyearsofexperiencetobuildagreat-lookingwebsite. Itdoesn’thetocostafortune,either!I’vebeenbuildingwebsitesforovertenyearsandreviewingwebhostsandwebsitebuildersforalmostaslong.Therearetwowaysyoucanbuildawebsite.Thefirstoptionistouseawebsitebuilder–aplatformthat’sdesignedtomakeiteasyforanyonetobuildawebsite,evenwithnopreviousexperienceortechnicalskills.ThesecondwayistouseWordPress.Thiscantakealittlemorework,butit’sstillprettyeasyifyouaretechnicallyinclined,anditgivesyoumoreflexibility.Emailmarketinghasthepowertogrowyourbusinessquickly.Ithasahighclick-throughrate(CTR),too–upto100xbetterthansocialmediachannelslikeTwitter.Ifyou’reshortontime,youcanhopovertoFiverrandhireaprofessionalwebdesignertobuildyouaWordPresswebsiteforaslittleas$5.I’mgoingtobeexploringbothoptionsinthisguide,sokeepreadingtofindoutwhichistherightchoiceforyou.Option1:UsingaWebsiteBuilderAwebsitebuilderisanonlinetoolthatmakesitsupereasytobuildawebsite.Websitebuilderscanbequitepowerfulbutrequirenocodingortechnicalskills,whichmakesthemaccessibletobeginnersandusefulforprofessionals.Theirintuitiveinterfaceandflexiblefeaturesmeanthatyoucanuseabuildertocreateawebsite thatlooksgreatinamatterofhours–orevenminutes.Mostwebsitebuildersarebudget-friendly,andmanyofthemofferfreeplansorfreetrials,soyoucangetstartedwithouthingtospendadime.Websitebuilderscomewithpre-designedtemplatesthatsetthestyle,layout,andcolorschemeofyoursite.Allyouhetodoispickoneaddyourowncontentandimes,andpersonalizeitwithyourownbranding. Dependingonthebuilder,you’llheaccesstodifferentmethodsofbuildingandeditingyoursite.Ipersonallypreferdr-and-dropediting,asitgivesyoumorecontroloverthelayoutwhilekeepingtheprocessprettysimple.Youcanpositionelementswhereveryoulike,oraddnewelementsbysimplydrgingthemintoplace.Somebuildersofferaselectionofappstochoosefrom.Thisisaneasywaytoaddfunctionalitytoyoursiteorintegrateitwithanotherservice.Youcanaddamailinglist,anappointmentbookingsystem,alivechatbox,orprettymuchanythingyoucanimine,usuallyatnoaddedcost.Thoughthereareplentyofwebsitebuildersoutthere,theirqualitygreatlyvaries.MypersonalforiteisWix,asitoffershundredsoftemplatesandgreatflexibility,withlotsoffree(andpaid)apps. Checkoutourguidetothebestwebsitebuilders forsomeotherexcellentchoices.UsingaWebsiteBuilder:Step-by-StepGuide1.DecidewhatkindofwebsiteyouwanttobuildWithmostwebsitebuilders,youcancreatejustaboutanytypeofwebsiteyoucanimine.Youmaywanttocreateapersonalwebsite,ablog,anonlineportfolio,orinteractivearesumé/CV.Ifyou’reanentrepreneur,youmightneedawebsiteforyourbusiness,oranonlinestoretosellyourproductsorservices.Youdon’tevenneedtolimityoursitetoasinglepurpose.Forinstance,youmightwanttocreateawebsiteforyourbusinessthatalsohasaportfolioofyourworkandanonlinestore.Withtherightbuilder,thepossibilitiesareonlylimitedbyyourimination.2.ChoosetherightwebsitebuilderforyourneedsBuilderswillhedifferentstrengthsandfeatures,soyouneedtochoosetherightbuilderforyourneeds.Forexample,whilemostbuilderscomewithsomesortofonlinestorefeatureoradd-on,abuilderlikeShopifyisspecificallydesignedfore-commerce.Ontheotherhand,itsgeneral-purposefeatures,suchasblogging,areverylimited.Formymoney,themostflexiblewebsitebuilderisWix.Ithasexcellente-commercefeatures,tonsofapps,anditsdr-and-dropeditorgivesyoucompletecontroloverhowyourwebsitelooks.Wixsitsatthetopspotofourbestwebsitebuilderslist,andI’llbeusingittodemonstratethestepstobuildingyourwebsiteinthisguide.That’snottosaythatit’syouronlyoptionthough–youshouldbeabletofollowthesestepswithmostqualitywebsitebuilders.OurWebsiteBuilderRecommendationsNotsurewhichbuildertochoose? Herearesomerecommendationsfordifferentpurposes.Ifyou’relookingforfulldesignfreedomandeasyeditingcapabilities,Wixismygo-torecommendationbecauseofitsflexibilityandfunctionality.Thefreeplanisoutstanding,anditallowsyoutobuildafullyfunctionalwebsite(notwithstandingsomelimitations).Evenwithafreeplan,youcanenjoyreliablewebhostingandaround-the-clockmaintenanceandsecurity.Themostbeginner-friendlybuilderonthislist,SITE123offerseasyandquickwebsitebuilding.Ifyoudocreativework–photography,design,writing–thenSquarespaceisthetopchoice. Itshigh-qualitytemplatesareperfectforshowcasingyourcreativetalent.Ifyouneedtocreateasiteforyourencythatattractsclientsandinvitesconfidence,IONOSofferssimpledesignwithprofessionalresults.Italsocomeswitheasy-to-usetoolsfore-commerce.Ifyouneedadazzlingonlinestorewithadvancede-commercefunctionalitieslikeinventorytracking,productvariations,andbusinessanalytics,youcan’tgowrongwithShopify.Ithashundredsofappsandtonsoftoolstohelpyouboostyour sales.TryWixforFree>>3.ChooseaplanMostwebsitebuildersheafreeplan,oratleastafreetrialperiod.Ifyou’rejustgettingstartedwithyourwebsite,orifyourbudgetistight,afreeplancanbethebestsolution.Freeplansgiveyouthechancetotryoutawebsitebuilderwithoutinvestingupfront.Thedownside,however,isthatfreeplansoftencomewithalotofrestrictions.You’llbelimitedtousingyourwebsitebuilder’sURL(e.g.,username.wixsite.com/yourcompany).That’sfineifyou’recreatingawebsiteasahobby,butifyou’reusingyourwebsiteforbusiness,youreallyneedacustomdomainname(yourcompany.com)that’seasyforyourcustomerstoremember.Also,ifyouuseafreeplanyourwebsitewillbefullofthebuilder’sbranding,whichcanlookunprofessional.Freeplansalsotendtorestricttheamountoftrafficyoucanget,andmanyusefulfeaturessuchasinstallingappsoraccessingtoolsfore-commercemightbelockedbehindapaywall.Ifyou’reseriousaboutyourwebsite,you’lllikelyneedtoupgradetoapaidplan.It’simportantthatyou knowthetypeofwebsiteyouwanttobuildbeforechoosingaplan.Thatway,youcanselectaplanthat’sbettersuitedtobothyourbudgetandyourneeds.Forexample:Ifyouwanttosellonline,you’llprobablywanttogoforadesignatedbusinessplan(or,attheveryleast,aplanwiththenecessarytoolsfore-commerce).Wixhasgeneralandbusiness/e-commerceplanstochoosefrom,butyoucanonlyacceptonlinepaymentsonthebusiness/e-commerceplans.Ifyouwantto showcaseyourworkbyhostingalotofvideosorhigh-resolutionimesonyourwebsite,you’llneedaplanwithalotofstoreandbandwidth.Forinstance,Squarespacegivesyouunlimitedphotostoreoneveryplan,includingitscheapest.Irecommendgoingforthelowest-pricedplanthatgivesyouallthefeaturesyouneedrightnow.Ifyourneedschange,youcanalwaysupgradetoahigher-pricedplaninthefuture.4.Getstarted:ChooseatemplateThefirststepintheprocesswillalwaysbechoosingatemplate.Allwebsitebuildersusetemplates(somebuilderscallthemthemes,buttheymeanthesamething)asthebuildingblocksofyourwebsite.Templatesareprofessionallydesignedtoworkonalltypesofdevices,andtheyallowyoutogetyourwebsiteonlineinarelativelyshortamountoftime.Thetemplatesetsthestyleandgenerallayoutofyourwebsite(althoughyoucancustomizeitlater),providingyouwithaframeworkthatyoucancustomizeandusetoaddyourowncontent.Mostwebsitebuildershetemplatelibrariesthatyoucanbrowseevenbeforeyousignup.Templatesarearrangedincategories,asyoucanseeinthescreenshotfromWix’stemplategallery.Categoriesaren’tmeanttoberestrictive(it’snotthatyoucan’tuseaportfoliotemplateforyourblog),buteachcategorycontainstemplatesthatarespecificallydesignedfordifferenttypesofwebsites.Thebesttemplateslookfantasticrightoutofthebox.AsfarasI8217;mconcerned,Squarespacehassomeofthemostvisuallystunningtemplatesoutthere.Choosethetemplatethatbestmatchesyourvision5.CustomizeyourtemplateTechnically,youdon’thetomakeanycustomizationstoyourwebsitetemplateonceyou’vechosenit–butregardlessofhowwell-craftedatemplateis,customizingyourwebsiteiswhattrulymakesityourownandsetsitapartfromotherwebsites(especiallythoseusingtheexactsametemplate).Agoodplacetostartwouldbechangingyourtemplate’scolorsandfontstomatchyourbusinessbranding.Althoughdifferentbuilderswillgiveyouvariedlevelsofcustomization,oneofthehugeadvantesofusingabuilderisthattheymakecustomizationrathereasy.Whileeachwebsitebuilderwillheitsownuniqueeditor,everythingI’mabouttodemonstrateinWixcanbeaccomplishedthroughsimilarstepsinotherbuilders.ChangingfontsChangingthefontsonWixissimplyamatterofclickingonthetextyouwanttochangeandhittingtheEditText button. YoucanediteachtextboxseparatelyorusetheSeTheme optiontoapplyyourfontchangesacrossyourwholewebsite.WithWix,youcanchoosedifferentfontsfordifferenttexttypes–forinstance,youcanchooseonefontforHeading1touseasyourmainheading(likeinthetemplateI’mdemonstratingbelow),andanotherfontforyoursub-headings.Youcanevenheadifferentfontforparraphstyles,ifyoulike.WixgivesyouanamazinglevelofcustomizationoverglobaltextstylesSomewebsitebuildersonlyallowyoutochangethefontstyleforthewholewebsite,ratherthanforindividualheadingsandparraphs.Thoughthatlimitsyouroptionssomewhat,I’drecommendyoukeepaconsistentstylethroughoutyourwebsiteanyway.ChangingcolorsYoucaneasilychangethecolorofyourfontsinthetextsettingsbox,butit’sjustaseasytochangethecolorofotherelements,likebackgroundsofcolumns.Forexample,youcanuseasolidcolorbackgroundusingthecolorpickertoolasdemonstratedinthescreenshotbelow.Wixautomaticallycreatescomplementarycolorpalettestomatchyourtheme,butyoucanchangethepalettesbyusingthe“changeyoursitecolors”option. Youcanalsoaddyourowncolorstomatchyourbranding.WixhaseasyoptionsforchangingcolorsandbackgroundsMovingelementsaroundonyourpesDr-and-dropeditorsmakerearrangingyourpe’scontentasimplematterof,well,drgingitfromoneplacetoanother.Wixisuniqueintheamountofcontrolitgivesyouoverarrangingyourpe’slayout,but otherdr-and-dropeditorswillgiveyousimilarfeatures.Othereditorsmayofferanup/downbuttonmethodformovingsectionsaroundonyourwebpe.Blockeditorsworklikeamiddlepointbetweenthetwo,withpre-madeblocks(text,ime,video,columns,etc.)thatyoucanarrangeinagrid,givingyoumoreflexibilitythanjustmovingcontentupordown,butnotasmuchroomtoplayaroundwithasadr-and-dropeditor.OnethingthatIparticularlylikeaboutWixistheZoomOutandReorder function.Thisallowsyoutoviewyourwholewebpeandeasilymovesectionsand/orelementsaroundonthepe.Below,youcanseehoweasyitistomovecontentusingthistool.UsingWix’sdr-and-dropeditortorearrangesections6.AddyourowncontentWhenitcomestoaddingyourowncontent,allyouhetodoisreplacethe“placeholder”textandimesinyourtemplatewithyourowntextandmedia.Itmighttakesometime ifyouhealotofcontent,buttheoverallprocessisreallysimple.Ifyoudon’theyourownimes,mostwebsitebuildersoffersomekindofimebankthatallowsyoutoinstantlyaddfreeimestoyoursite.HowtoaddtextYoucanaddnewtextsectionstoyourwebpesinjustafewclicks. InWix,youusetheAdd toolinthetoolbarontheleftandthenselectText inthepop-outmenu.Irecommendsettingupthemainareaswhereyouwanttoaddtextfirstandthengoingbacktoaddyourcontent.YoucanuseourfreeLoremIpsumGeneratortocreateplaceholdertexttouseuntilyou’rereadytoaddyourowntext.ChoosefromawidevarietyoftextstylesHowtoaddanimeLikeaddingtexttoyourwebsite,addingimesisincrediblyeasy.InWix,opentheAdd menu,selectIme (directlybelowText),andchoosefromtherangeofimesources.Youcanuploadyourownimes,usefreeWiximesandillustrations,searchtheUnsplashimesdatabase,orchoosepremiumstockimesfromShutterstock(foranaddedfee).Then,allyouhetodoisplacetheimewhereyouwantitonyourpe.YoucanalsousetheAddImetooltoaddalogotoyourwebsite.I’vegotsomeadviceaboutlogosfurtheroninthisarticle.Ifyou’reusingfreeWixorUnsplashimes,thesemaybealreadyoptimized8211;meaningthatthey’vebeencompressedtosmallerfilesizesothattheywon’tslowyourwebsitedown.Ifyou’reusingyourownhigh-resolutionimes,however,it’sagoodideatoreducethefilesizesbeforeyouuploadthem.That’seasytodowithafreetoolsuchasourImeCompressor.WixoffersmultiplewaysofaddingimestoyourwebsiteHowtoaddapetoyourwebsiteMosttemplateswillcomewithseveralpre-designedpes,suchasHome,AboutUs,andContact.Ifyouwanttoaddmorepes8211;aServicesorMyWorkpe, forexample8211;youcandothisbyclickingtheMenusandPesbuttononthelefttoolbarandselectingtheAddPe buttonatthebottomofthepop-outmenu.AddinganewpeinWixcouldn’tbeeasierWhenyouaddanewpetoyoursite,itwillautomaticallyshowupinyournigationmenu.7.AddappsAppsarethird-partyornativeintegrationsthathelpexpandthefunctionalityofyoursite.Althoughnotallwebsitebuildersheapps,somebuilderslikeWixhehundredsofappstochoosefrom.Manyofthemarefree,andeventhepaidappsoftencomewithafreeversionorafreetrialperiod.Youcanuseappstoaddextrafeaturestoyourwebsiteinamatterofminutes.Forinstance,Wix’sappmarketallowsyoutoaddfeatureslikeonlinebooking,livechat,newslettersignup,socialmediaintegration,andmuchmoretoyoursite.TheWixappmarketoffershundredsofoptionstoexpandyoursite’sfunctionalityToaddappstoyourWixsitejustclicktheAppMarketicon(itshouldappearasfoursmallsquaresonthelefttoolbar).Fromhere,youcansearchforaspecificapp,orbrowsethecategoriestofindnewideas.Onceyou’vefoundanappyoulike,justclickonit,andthenselectAddtoSite.Withacoupleofclicks,installappsdirectlyfromWixAppMarketOncetheappisinstalled,it’simmediatelyailableonyourwebpe.Inthisexample,IaddedtheRolloverImeEffectsappforadvancedimeeditinganditwasailableonmywebpewithin30seconds!8.ChooseadomainnameBeforeyoupublishyourwebsite,you’llneedtochooseadomainname.Ifyou’reonafreeplan,you8217;llhetouseasub-domain(e.g.yourusername.wixsites.com/yourwebsitename).Ifyousignupforanannualpaidplan,mostbuilderswillincludeafreecustomdomainnameforthefirstyear.Mostwebsitebuilderswillgiveyoutheoptionofregisteringandsettingupyourdomainname.Thatmeansthatallyouhetoworryaboutischoosingthebestdomainnameforyourwebsite.Hingtherightdomainnameisabsolutelycrucialthough,sodon’trushthisstep!Evenwiththeperfectnameinmind,oneofthebiggestissuesyou’llhetodealwithiswhetherthedomainnameyouwantisactuallyailable.Ifyou’rehingtroubledeciding,checkoutour completeguidetochoosingyourdomainname!9.PreviewandpublishyourwebsiteNowthatyou’veaddedallyourcontentandchosenyourdomainname,it’stimetogetyourwebsiteonline.Withmostwebsitebuilders,thisisreallyjustamatterofclickingabutton(ortwo).Don8217;trushtohitthePublishbuttonyet–it’salwaysagoodideatousethePreviewoptiontomakesureyou’rehappywithyoursitebeforegoinglive.Previewingallowsyoutoseeyoursitethesamewayyourvisitorswill,withoutthedistractionsoftheeditor.Besides,ifthere’sanyspotwhereyouforgottoaddyourcontent,oranyblankpesyouforgottofill,previewingyoursitecanhelpyoucatchthosesmalldetailsbeforeanyoneelsedoes.Mostbuilderswillalsoletyoupreviewthemobileversionofyoursite.Alwaysmakesurethatyoursiteworksandlooksgoodonmobiledevicestoo.Whenyourwebsiteispublished,youcaneasilyviewandshareitOnceyouhitPublish,yourwebsiteislive,andyoucanstartpromotingit!WebsiteBuilderComparisonTableWebsiteBuilderFreePlanDr&DropApps/IntegrationsTemplatesStartingPriceWix✔✔✔900+$0ReadReviewSquarespace✘✔✔140+$16.00ReadReviewHostingerWebsiteBuilder✘✔✔100+$2.49ReadReviewIONOS✘✔✘18$6.00ReadReviewSITE123✔✘✔240+$0ReadReviewWordPress.com✔✘✔140+nativeThousandsofthird-partytemplates$4.00ReadReviewWebnode✔✔✘110+$3.90ReadReviewShopify✘✘✔70+$29.00ReadReviewBigCommerce✘✘✔200+$29.00ReadReviewSquareOnline✔✘✔1$0ReadReviewWebsiteBuilderFAQWhichwebsitebuilderistheeasiesttouse?Thereareseveralwebsitebuildersthatareveryeasytouse,suchasIONOSandSITE123.However,Wixismytopchoice becauseitmanestogiveyouatonofdesignfreedomwhilestillbeingimpressivelyeasytouse.Notonlyisitincrediblyintuitive,butitalsohasmorefeaturesthanalmostanyotherbuilder.WillmysiteappearonGoogleandothersearchengines?Yes,yourwebsitewillshowupinsearchengineresults.Butit’snotenoughtojustshowup–youalsowantyoursitetorankashighlyaspossible.AllwebsitebuildersofferSEO(searchengineoptimization)featurestohelpimproveyoursearchresultranking.Insomecases,you’relimitedtoaddingyourownmetatitlesanddescriptions.Otherwebsitebuilders,however,willgiveyoumoreadvancedSEOfeatures.Forexample,WixoffersanSEOWiz,which givesyoupersonalizedSEOrecommendationsandstep-by-stepinstructionsonhowtogetyourwebsitenoticed.Willmysitelookgoodonmobiledevices?Thesimpleanswertothisquestionis‘yes.’Mostwebsitebuilderseithergiveyouoptionsformobile-responsivetemplates(meaningyoursitewillautomaticallyadjusttothescreensizeofmobiledevices)orheamobilevieweditorsoyoucaneditthemobileversionofyourwebsiteseparately.Ifyouwanttocheckthatyourwebsiteismobile-responsive,youcanuseourfreeResponsiveCheckerTool.DoIneedadedicatede-commercebuilder?Itreallydependsonhowmanyproductsyouplanonsellingand themainpurposeofyourwebsite.Foraregularblogthatsellsmerchandiseontheside,aregularwebsitebuilderwithe-commercefeaturesismorethanenough.That’sbecausee-commercebuildersaregenerallysofocusedonsellingthattheirbloggingtoolsaren’tallthatgreat.Wixgivesyouthebestofbothworlds,withgreattoolsforcreatingcontentand astrongsetofe-commercetools.However,ifyou’replanningtosellalotofproductsthroughyourownonlinestore,thenI’ddefinitelyrecommendadedicatede-commercebuilderlikeShopify.E-commercebuildershemorepowerfulsalesmanementtools,andsomeevenletyousellviaInstramandFacebookaswell.CanIhiresomeonetobuildmysiteforme?Yes,youcertainlycan!Ifyoudon’thethetimetobuildyourownwebsiteoryou’djustratherheaprofessionaltakecareofitforyou,youcanhireawebdesignerforaslittleas$5onFiverr,thebestmarketplaceforfindinglow-costfreelancers.Option2:UsingWordPressWebsitebuildersareabsolutelytheeasiestwaytogetyourwebsiteonline,buttheycanbealittlemoreexpensivethanusingWordPresswithawebhostingplan.Ifyou’relookingforabudget-friendlyoptionandyoudon’tmindaslightlymoretechnicalsite-buildingprocess,thenWordPressmightbethechoiceforyou.Now,therearetwoversionsofWordPress:WordPress.com,whichisasimplifiedversion,andself-hostedWordPress.org.Inthissection,I’llbediscussingself-hostedWordPress.WordPressisn’tquiteassimpletouseasawebsitebuilder,butit’sstillprettyeasytogetstartedwith–anditsmassiverangeoffreetemplatesandpluginsgiveyoualmostlimitlessoptionsforcustomizingyourwebsite.Thoughtheprocessisabitmoretechnical,youdon’tneedtoknowhowtocodeorhealotofexperiencetobuildagreat-lookingwebsitewithWordPress.Ifyou’dratherheaprofessionalbuildyourWordPresswebsiteforyou,thenyoucanalwayshireadeveloperonFiverrforaslittleas$5. Findoutmoreaboutthisbelow.Step-by-StepGuide1.ChooseahostingplanAlthoughWordPressitselfis100%free,you’llhetosignupforwebhostingtomakeyourwebsiteailableonline(unlikewithwebsitebuildersthatprovidehostingwiththeirplans).Foramorein-depthlook,youcancheckoutourshortlistofthebestwebhostsin2024.Therearelotsofwebhostingoptionsailable–butherearetheonesthatconsistentlytopourrecommendations.OurTopWebHostRecommendationsforWordPressWebsitesHostinger8211; Oneofthecheapesthostingprovidersaround,Hostingerisidealifyou’reonabudget.Itsexcellentloadingspeeds(thatwe’vetestedthoroughly)andsimple1-clickWordPressinstallermakeitouroverallbestchoice.IfyouoptformanedWordPresshosting,you’llbenefitfromenhancedsecurityandserversthatareoptimizedforWordPress.InterServer–Withitslowmonthlyhostingpriceandunlimitedstore,InterServerisanexcellentsolutionifyou’reagrowingbusiness.BecauseitsserversarelocatedintheUS,itcanprovidegreatloadingspeedsforaUS-basedtargetaudience.A2Hosting8211;OfferingstandardsharedhostingormanedWordPresshosting,A2Hostingisa‘green’hostingcompanythatworkstoreduceitscarbonfootprint.Itdeliversgreatspeeds,andit’salsogreatforsecurity,withitsownHackScanthreatdetectionandremovaltoolthat’sincludedfree.Nexcess8211;Ifyoudon’tmindgoingforamorecostlyoption–solongasyouget premiummanedhostinginreturn–NexcesscouldbethebesthostingoptionforrunningyourWordPresswebsite.WithNexcess,youcanrestassuredthateverypartofthehostingprocessisbeingtakencareofbyconsummateprofessionalsKinsta–Manedhosting(i.e.,allthehardworkcomespre-done)andlightingfastspeedsmakeKinstaafantasticchoiceinalmostanyregard,solongasyoudon’tmindalighterwallet.Despiteitsfantasticvalue,Kinstaisstillquitepricey,butrestassured,you’repayingpremiumpricesforapremiumservice.InMotionHosting–Anothertop-tierchoiceforUS-basedhosting,InMotionHostingsacrificessome(thoughnotthatmuch)ofInterServer’sspeedinexchangefortop-tiersupport.Ifyou’relookingforgreathostingwithintheUS,anddependabilityisonthetopofyourlist,InMotionmightjustbethechoiceforyou.SeeHostinger’sBestDeals>>Whenyou’rechoosingahostforyourWordPresswebsite,therearesomefeaturesyoushouldlookfor:SSLcertificate.AnSSLcertificatemakesyourwebsitesecure,ensuringyoursitehasthelittlepadlockiconintheaddressbarofwebbrowsers.Mostwebhostswillincludeoneforfree.Onceyourwebsiteislive,youcancheckthattheSSLcertificateonyourwebsiteisworkingproperlywiththeSSLCheckerTool.WordPressoptimization.ThebestwebhostsforWordPresshespeciallyoptimizedserverstoimproveperformance,soyourwebpesloadfaster.Securityfeatures.Somewebhostschargeyouextraforessentialsecurity,soyoushouldtrytofindonethatincludesimportantfeaturessuchasmalwareprotection,firewalls,andautomaticbackups.2.ChooseadomainnameThisprocessisprettymuchthesame forusingWordPressasitisforwebsitebuilders.Somewebhostsincludefreedomainnameswithannualplans,butnotalldo.Ifyouchooseahostthatdoesn’tofferafreedomainname,itmaybecheapertobuyyourdomainnamefromathirdpartyratherthanthroughyourwebhost.Youcanpickupadomainnameforaslittleas$1onsomedomainmarketplaces.3.Useaone-clickinstallertoinstallWordPressSomehostingplanscomewithWordPresspre-installed.Ifyourplandoesn’t,don’tpanic8211;youcanusetheone-clickinstallerprovidedbyyourhost.“One-click”mightbeabitofamisnomer,butit’snottoofaroff–withjustafewclicks,thesetoolssetupallthescriptsanddatabasesneededtomakeWordPressworkonyourwebsite.AllyoureallyhetodoiscomeupwithausernameandpasswordthatyouwanttousetologintoWordPressoncetheinstallationiscomplete.Differenthostsmayusedifferentone-clickinstallers,butessentiallythey’reallthesame,andthey’reallveryeasytouse.MostWordPressinstallerswillbesimilartothisonefromSiteGround4.AccessWordPressthroughyourhostingdashboardTheexactwayyou’llaccessWordPressmayvarydependingonyourwebhost.Inmostcases,however,you’llfindtheoptionformaningyourWordPresswebsiteinyourhostingdashboard.I’llbedemonstratingthisusingSiteGround.Inthescreenshotbelow,youcanseethatthere’sabuttontoautomaticallylogintomyWordPresswebsite’sdashboard.OtherhostsmightmakeyoutypeinyourWordPressusernameandpasswordtologin.SiteGroundoffersaone-clickloginoptionforyourWordPressdashboardIfthisisyourfirsttimeusingWordPress,thedashboardmayseemalittleoverwhelming,butdon’tpanic,it’sactuallyquiteeasytonigate.Belowisascreenshotofthedashboardwithalltheimportantelementslabeledforyou.TheWordPressdashboardiseasytonigateonceyouknowwhereeverythingis!WordPressusessomejargonthat’sdifferentfromwebsitebuilders,sotomakethingseasy,here’sabriefrundownofthedifferentsectionsoftheWordPressdashboard:WordPressElementWhatItDoesWebsiteBuilderEquivalentPostsView,edit,andaddnewpoststoyourwebsite(seebelowformoreaboutpostsandpes)BlogMediaView,edit,anduploadnewimesandothermediatypes(e.g.,videos)GalleryPesView,edit,andaddnewpestoyourwebsitePesThemeInstallerViewexistingthemes,searchforfreethemesfromtheWordPressrepository,andaddthird-partythemesTemplatesCustomizerCustomizeyourwebsitecolors,fonts,layouts,andmore(dependingonthetheme),withalivepreviewofhowyourchangeswilllookDesignThemeSettingsNotallthemesincludethissection,butpremiumthemestendtohealargerrangeofsettingsthataren’tailableinthecustomizerviewN/APluginsViewandactivate/deactivateexistingplugins,searchforandinstallpluginsfromtheWordPressRepository,anduploadthird-partythemes.AppsSettingsChangebasicsettingssuchasyoursitetitle/subtitle,dateformat,andpermalinks(theURLstructureofpesandposts).Settings5.ChooseathemeThemesinWordPressareverysimilartotemplatesinwebsitebuilders.ThebiggestdifferenceisthatinWordPress,themescontrolmorethanjustthegeneralstyle/layoutofyourwebsite.Aparticularthemecanoftenincludecertanplugins(or“requiredplugins”.)Inthethemespanel,viewallthethemesyouheinstalledWordPress8217;defaultthemeisprettybasic,soyou’reprobablygoingtowanttolookforadifferentone.Thankfully,theWordPressthemeinstallermakesthisextremelyeasy.YoucansearchtheWordPressthemerepositorytofindandinstallanyofthethousandsoffreethemesailableinaninstant.Youcaneveninstallmultiplethemesandusethecustomizertoseehowtheywilllookonyourwebsitebeforeactivatingthem.Searchfor,install,andactivatefreethemesfromtheWordPressrepositoryInadditiontothefreethemesofferedbyWordPress,youcanpurchasethousandsofpremiumthird-partythemesfrommarketplaceslikeTemplateMonster andThemeForest.6.AddpluginsPluginsaresimilartotheappsofferedbywebsitebuilders–theyaddextrafeaturestoyourwebsitethataren’tincludedinWordPressitself.Forexample,youcaninstallaplugintocreateacontactform(e.g.,NinjaForms)orbuildanonlinestoreusingWooCommerce.Chancesare,ifyoucanthinkofafeature,there8217;sapluginforit,fromSEOtocreatinganonlineportfolio.YoucaneveninstallmultipleUsethesearchboxtohelpyoufindthepluginsyouneed.There,you’llalsofindinformationabouteachplugin,includingwhetherit’scompatiblewithyourversionofWordPress,whatfeaturesithas,andwhatotherusersthinkaboutit.FindandinstallpluginseasilyinWordPressItonlytakesasingleclicktoinstallaplugin,butyourpluginswillonlyworkonyourwebsitewhenyouheclickedthe“activate”buttoninthepluginspanel.7.CreateyourfirstpostOneofthemostfrequentquestionsIgetaskedaboutWordPressisregardingthedifferencebetweenpesandposts.Essentially,pesarethestaticcontent8211;i.e.,thecontentonyourwebsitethatdoesn’tchangeordoesn’tchangeveryoften,suchasanAboutUs pe.Postsaremoredynamic–theyshowuponthe‘blog’peorcategorypesofyourwebsite.ThekeydifferencebetweenpesandpostsisinthewayWordPressdisplaysthemonyoursite.Theeditorforcreatingpostsandpesisexactlythesame,sotheprocessforcreatingpesandpostsisidentical.Inthescreenshotbelow,youcanseethatwhenyouclickonthe“posts”panelofthedashboard,you’llseealistofyourexistingposts(somethemescomewith“demo”content),withanAddNew buttonatthetop.ThepostspanelinWordPressClickingtheAddNew buttonwilltakeyoutotheeditor.WordPress’sdefaulteditorusedtobeprettybasic,buttheGutenbergversionthatwasintroducedwithWordPress5.0,alongwiththenewfeaturesof6.0,giveyoumuchmoreflexibility.Gutenberguses“blocks”tocreateyourpostsandpes,alongwithlayouts(columns),sections,andcontainers.Usingfreeplugins,youhetheoptiontoaddmoreblockstotheGutenbergeditor.Additionally,third-partysite-buildingpluginsallowyoutoalterthewayyouedityoursite.GutenbergblockpluginsexpandthefeaturesoftheWordPresseditorBlocktypesincludedinthestandardGutenbergeditorinclude:ParraphHeadingQuoteImeListCoverimeGallerySlideshowTableButtonsTochooseablock,youcanclickthe“+”iconatthesideofeachparraphareaortype“/”intothefreespacelabeled“startwritingortype/tochooseblock.”ThepostandpeeditorinWordPress8.PublishyoursiteUnlikesomewebsitebuilders(suchasWix),WordPressdoesn’theaspecificPublish buttonforyourwholewebsite.AssoonasyoucreateyourWordPresswebsite,it’sliveontheinternet. However,therearethreeseparateplaceswhereyou’llfindPublish buttonsinWordPress.Theseare:Inthecustomizer,whereyou’llseeabuttonatthetopofthepanelwhichseschangesandmakesyourcustomizationslive.Atthetoprightofeachnewpostyoucreate,youwillfindtheoptiontopublish.Untilyouclickpublish,yourpostwillremainadraftandwon8217;tbevisibletoothers.Ifyoudecidetomakeeditslateron,simplyclickupdatetomakeyourchangesgolive.Atthetoprightofeachnewpeyoucreate.Aswithposts,yourcontentisjustadraftuntilyoupublish,andwhenyoumakeeditsyouneedtoclickupdateoryourchangeswon’tbesed.ThethreeareaswhereyouneedtoclickpublishinWordPressConsiderSpending$5onaWebDeveloperandSeTimeandFrustrationIfyou’reshortontimeorjustdon’twanttodealwithanyproblemsthatcouldoccurwhenbuildingaWordPresswebsite,thenhiringaprofessionaltobuild(and,perhaps,maintain)yourwebsitecouldbeabetterchoice.Hiringadevelopersuresoundsexpensive,butthankstotheriseoffreelanceplatformslikeFiverr,youdon’thetospendasmallfortune.IjustdidaquicksearchonFiverrforfullWordPresswebsitecreationandfoundplentyofprofessionalwebsitedesignersofferingtobuildyourwebsiteforaslittleas$5!Low-costwebdevelopersonFiverrforaslittleas$5OneofthegreatfeaturesofFiverristhatitallowsyoutoviewsamplesofadesigner8217;sworktoseeiftheyareagoodmatchforthekindofwebsiteyouneed.Moreover,Fiverrensuresyou8217;recompletelysafebecausetheplatformholdsbackyourpaymenttothefreelanceruntilyou8217;repleasedwiththeirwork.FindaDeveloperonFiverr>>WordPressFAQIsWordPressfree?Technically,yes.Theplatformitselfis100%free,butyouwillhetopayforwebhostingandadomainname(clickhereforalistofthebestwebhostsin2024).Ifyouwantapremiumthemeorpluginfromathird-partymarketplace,you’llhetopayafeeforthese,too.CanIbuildaWordPresssiteonmyown?Yes,youcanbuildaWordPresswebsitewithouthiringadeveloper–butifyou’renewtowebsitebuilding,you’llprobablyfindWixmucheasier(andfaster)touse.WordPressismorecomplexandit’seasiertomessupyourwebsitewhenmakingchangestosettingsorbyinstallingpluginsthatconflictwithoneanother.HiringadeveloperforyourWordPresswebsiteisn’tasexpensiveasitsounds!YoucanactuallyfindadevelopertomeetanybudgetonFiverr.What’sthedifferencebetweenWordPress.comandWordPress.org?ThemaindifferencebetweenWordPress.comandWordPress.orgisinthewaythey’rehosted.WithWordPress.com,youdon’thetopayseparatelyforhostingbutyouwillneedtoupgradetooneofthehighest-pricedplans(BusinessoreCommerce)tousepluginsanduploadthemesfromthird-partymarketplaces.WordPress.orgisself-hosted,soyoupayforhostingseparately.YouhecompletecontrolandfreedomwiththisversionanditcanworkoutmuchcheaperthanWordPress.com.Whatisbetter,Wix,orWordPress?ThereareprosandconstobothWixandWordPress.Wixismorebeginner-friendly butitcancostmorethanbuyingahostingplanandbuildingyoursitewithWordPress.WordPressgivesyoualotofflexibilityandgivesyoumoreoptionsforgrowingyoursiteovertime,butitcanbetrickiertolearnandthere’spotentiallymorethatcangowrong.Forexample,incompatiblepluginscancauseyourwebsitetostopworking.DoIneedaspecialWordPresshostingplan,orisabasichostingplanenough?Youdon’tneedaspecialWordPresshostingplan,asWordPresswillworkonanysharedhostingplanthathasaone-clickinstaller.However,therearedefinitebenefitstochoosingaWordPress-specifichostingplan.WordPress-specifichostingplanscanbemanedorunmaned.Withunmanedplans,yourhostingisprettymuchthesameasbasichosting,butyourwebsitewillbehostedonserversthatareoptimizedforWordPressandyoumightgetaccesstosomeoptimizationplugins.ManedWordPresshostingisthehassle-freeversion,asyourhosttakescareofthingslikeupdates,securitypatching(dependingonthehost),andbackups,soyoucanjustgetonwithbuildingyourwebsite.SeeourlistofthebestmanedWordPresshostingprovidersin2024.TakingYourWebsitetotheNextLevelNowyou’vebuiltyourwebsite,it’stimetogetitnoticed.Inmyexperience,you’renevercompletelyfinishedwithbuildingawebsite,sinceyoucanalwayskeepupdatingit,changingthingsandmakingitbetter.Youwantpeopletostartvisitingyourwebsiteassoonaspossible.Luckily,thereareanumberofthingsthatyoucando togrowyouraudienceandgiveyoursitevisitorsabetterexperience.DesigningaLogoYoudon’tneedtohealogobeforeyoustartbuildingyourwebsite,butalogomakesyourwebsitelookmoreprofessional andcanhelpbuildyourbrand.Yourlogosaysalotaboutyou,soit’simportanttotaketimetogetitright.Therearedesigntrendstotakeintoconsideration8211;forinstance,heyouthoughtabouttheimpactyourcolorschemecanheonyourtargetaudience?ReadmoreaboutthelatestlogostatisticsfromtheFortune500list toexplorethisfurther.Therearetwowaystogetyourselfalogo–andbothareaffordable.MycolleueactuallytestedallthemajorlogodesignservicestofindanewlogoforWebsitePlanet.Toreadallabouthisexperimentandseewhowon,readourfullcomparisonofthebestonlinelogodesignservices.1.DoItYourselfwithanOnlineLogoMakerTheDIYmethodmaysoundlikethecheapestwaytogetalogo–butthisisn’talwaysthecase.Mostonlinelogomakersarefreetotry,butyouwillhetopaytodownloadanduseyourlogo. Thereareafewfreelogomakersoutthere,butthey’reverybasicandIdon’trecommendusingthem.MyforiteofallDIYlogomakersisWixLogoMaker.ThistoolusesAI(artificialintelligence)togeneratelotsoflogoideasbasedonyourownpersonalpreferences.Whenyouspotadesignyoulike,youcancustomizeeverythingfromthefontstothecolorscheme.Youcanevendownloadafreelow-resversionofyourlogosoyoucanseehowitmightlookonyourwebsiteandsocialmediabeforeyoumakeyourfinalpurchase.TryWixLogoMakerforFree>>2.HireaDesignerHiringalogodesignermightsoundexpensive8211;butonFiverr,youcangetaprofessionallydesignedlogoforaslittleas$5. MostFiverrdesignersdisplayexamplesoflogosthey’vecreated,makingiteasiertofindsomeonewhooffersthestyleyou’relookingfor.WetestedFiverr’slogodesignersourselves andwerereallyimpressedwiththequalityofthefinishedlogos.Inadditiontoyourlogo,you’llalsoneedtogenerateaficon–thisisthesmallimethatyouusuallyseeinbrowsertabsnexttothewebsitenameandinyourbookmarks.Youcancreateaficoninsecondswithourniftyficongeneratortool.OptimizingYourSiteEvenifyoubuildafabulouswebsite,it’snotgoingtoshowuponthefirstpeofsearchengineresultspes(SERPs)withoutsomeoptimization.Optimizingyourwebsiteinvolvessearchengineoptimization(SEO),analyzingyourtraffic,andunderstandingwhatyouraudienceislookingfor.ForSEO,therearesomegreattoolsthatyoucanusetomakeoptimizationeasier.OneofthebesttoolsailableisSEMrush(checkoutourGuidetoSEMrush tofindoutmore),butthereareotheroptionsifSEMrushisoutofyourbudget.We’vereviewedsomeofthebestSEOTools tohelpyouchoosetherightone.Creatingtherightcontentforyourwebsitemightseemlikeachallenge,butbyusinganalyticstoolstofindoutmoreaboutyouraudience(wheretheylive,theire,theirgender,andsoon),youcantailoryourcontentbetter.ReadourGuidetoGoogleAnalytics toseehowtogetthemostoutofanalyticstools.YoucanalsousetoolslikeAnswerthePublictofindoutwhatpeoplearesearchingfor.CheckoutourGuidetoAnswerthePublic formoreaboutthis.GrowYourAudiencewithEmailMarketingEmailmarketingisoneofthebestwaystogrowyouraudience–andtherearelotsoftoolstohelpyousucceedwithyourmarketingefforts.Emailmarketingpossessestheabilitytorapidlyexpandyourbusiness.Additionally,itexComo construir um site em 2022: Guia Passo a Passo Completohibitsahighclick-throughrate(CTR),surpassingsocialmediachannelslikeTwitterbyupto100times.Throughemailmarketing,youcanprovidecustomerswithenticingdiscountsandpromotions,encourethemtoshareyourbusinesswithothers,andoffervaluablefreeresourcestoenticevisitorsintosigningupforyourmailinglist.Togetthemostoutofemailmarketing,you’llneedtothinkaboutthefrequencyofyouremails,usingautomatedemails,andwhattoputinyouremailnewsletters.Formoretips,checkoutourcollectionofthemostimportantemailmarketingstats.Wehetestedandreviewedthebestemailmarketingplatforms.Notimetoreadabunchofreviews?Noworries,here’saquickoverviewofourforiteemailmarketingsolutions.ActiveCampaign–Thisis,handsdown,themostfeature-packedemailmarketingserviceonthemarket.It’stheindustry-leaderforautomation,thereare880+integrations,andithasthebestdr-and-dropeditorwe’vetested.Withsomanyfeatures,thereisabitofalearningcurvebutwithahugeknowledgebaseandsupportteam,it’sdefinitelyworthyourtime.Sendinblue –OfferingSMSmarketingaswellasemailmarketingtools,Sendinbluehasanaffordablesolutionthat’seasytouse.Itevenhasagenerousfreeplan.Youcancreateautomatedemails,addworkflows,andusetheoptionto“senditatthebesttime.”AWeber –Offeringauniquedr-and-dropcampaignbuilder,AWebergivesyoueverythingyouneedforsuccessfulemailmarketing.It’sverybeginner-friendlybutstillhasmorecomplexfeatures,suchassplit-testfunctionsanditcanconnecttomorethan5000appswithZapier.ConstantContact8211;Withhundredsofemailtemplatestochoosefromanda30-dayfreetrial(60-dayifyou’reintheUS),ConstantContactisanexcellentchoice.It’sgreatforcreatingautomatedemails,andit’sreallyeasytouse,meaningyoucangetstartedrightaway.BenchmarkEmail8211;Supportingmultiplelangues,BenchmarkEmailisatopchoiceifyournativelangueisn’tEnglish.Ithasafreeplan,too,thatletsyousendupto3,500emailspermonth.It’sgreatforbeginnersbuthasmoreadvancedtoolsthatyoucanuseasyougrowmorefamiliarwiththeplatform.GetResponse8211;Morethanjustanemailmarketingplatform,GetResponseisamulti-functionalplatformthatincorporatesmarketing,customerrelationshipmanement(CRM),andwebinarfeatures.There’sa30-dayfreetrial,too.TryActiveCampaignforFree>>FinalWordsPhew!That’salotofinformationwe’vecovered.Tosumup,hereareafewkeytakeawaysfromthisguidetobuildingyourownwebsite:Websitebuilders areagreatplacetostartwhenyou’reabeginner.Wix isoneofthemostflexibleofthemall,allowingyoutostartwiththebasicsandaddmoreadvancedappslater.WordPressisoftenregardedasmoredifficultthanwebsitebuilders,butitoffersmuchmorefreedom. It’salsoacheaperwayofgettingyourwebsiteonline,withlotsoflow-costwebsitehosting plansailable.Ifyoudon’thethetimetobuildyourwebsiteyourself,youcanhireadeveloperonFiverrforaslittleas$5.Whosaidworkingwithawebdeveloperhadtobreakyourbudget?Publishingyourwebsiteisn’ttheendoftheprocess.YoucankeepoptimizingandpromotingyourwebsitewithtoolsforSEO,analytics,andmarketing.Anyonecanbuildawebsiteanditdoesn’tmatterifyou’reabeginneroronlyheatinybudgettospend.Hefuncreatingyourwebsite! Werankvendorsbasedonrigoroustestingandresearch,butalsotakeintoaccountyourfeedbackandourcommercialreementswithproviders.Thispecontainsaffiliatelinks.AdvertisingDisclosure AndrésGánem Andréswritesaboutavarietyoftopicsaimedathelpingbusinessownersandmerchantsgrowandmanetheirventures.Thesetopicsinclude(butarenotlimitedto)websitebuilding,webhosting,projectmanementsoftware,andcreditcardprocessing.Andréshas3+yearsofexperienceasawriterandcontentcreator.He’salsoworkedasaprojectmaner,websitedesigner,andsocialmediamanerforavarietyofsciencecommunicationgroups. Followourexpertson InsidethisArticleOption1:UsingaWebsiteBuilderWebsiteBuilderComparisonTableWebsiteBuilderFAQOption2:UsingWordPressWordPressFAQTakingYourWebsitetotheNextLevelFinalWords RatethisArticle 4.7 Votedby126users Youalreadyvoted!Undo Thisfieldisrequired Maximallengthofcommentisequalchars Minimallengthofcommentisequal10charsTheemailisrequired Theemailisincorrect Submit Anycomments? 3comments RequiredFieldMaximallengthofcommentisequal5000charsMinimallengthofcommentisequal50chars0outofminimum50characters Submitacomment Reply View%sreplies View%sreply DanielaReplyThehostingcompanyprovidesexcellenthigh-qualityvirtualservers.Thespeedishighandthepriceisaffordableforme.Irecommendeveryonetousevirtualhosting.Reply anonymusReplyThankyouforthiscompleteandusefulguide,ItriedtogetaprofessionaldesignfromFiverrbutunfortunatelyitdidn'twork,Igotfinallyfor55andhonestly,itwasgreatReply Mihail-WSPTeam Thankyouforyourfeedbackandforsharingyourexperiencewithfindingaprofessionaldesignsolution!It'sgreattohearthatyoufoundvalueintheguideandultimatelyachievedaresultyou'repleasedwith.Yourjourneyoffersencourementtoothersexploringsimilarpaths. DanielleReplyBecarefulwhoyouhireonFiverrtohandleyourwebsite.Iunderstandyouprobablyheanaffiliatepartnershipwiththem,butIknowplentyofpeoplewhowereburnedbyFiverr“webdesignersanddevelopers”.WhileIdobelieveyoucancreateacost-effectivewebsitewithoutbreakingthebank,relyingontheselow-tierservicesbyusuallyunderqualified“freelancers”alwaysendsupcostingyoumuchmoreinthelongrun.Reply Readmorereviews Replyto 0outofminimum50characters Writeyourreply Thisfieldisrequired Maximallengthofcommentisequal5000chars Minimallengthofcommentisequal50chars SubmitaReply Completeyourreply Completeyourcomment Name Thenameistooshort Thenameistoolong Thenamecontainsinvalidcharacters Email Theemailisrequired Theemailisincorrect Notifymeaboutanyupdatesregardingmycontribution Submit Thankyou,-yourcommentwassubmittedsuccessfully! Wecheckallusercommentswithin48hourstomakesuretheyarefromrealpeoplelikeyou.We'regladyoufoundthisarticleuseful-wewouldappreciateitifyouletmorepeopleknowaboutit. Sharethisblogpostwithfriendsandco-workersrightnow: Thankyou,,yourcommentwassubmittedsuccessfully!Wecheckallcommentswithin48hourstomakesurethey'refromrealuserslikeyou.Inthemeantime,youcanshareyourcommentwithotherstoletmorepeopleknowwhatyouthink. Thankyouforsigningup! Onceamonthyouwillreceiveinteresting,insightfultips,tricks,andadvicetoimproveyourwebsiteperformanceandreachyourdigitalmarketinggoals! Sohappyyoulikedit! Shareitwithyourfriends! Orreviewuson 45050004 ReviewsWebsiteBuildersWebHostingLogoDesignServicesEmailMarketingServicesFreelanceWebsitesLandingPeCreatorsFormBuildersSocialMediaToolsCloudStoreProjectManementSoftwareCreditCardProcessingLLCServicesToolsCompressPNG/JPGFreeQRCodeGeneratorShareLinkCreatorDomainExpirationCheckerSiteDownorNotMultipleURLOpenerInformationAboutBlogNewsContactUsFAQDisclosureSitemapTestingMethodologyPrivacyPolicyTermsofUseDMCAPolicyPressFollowus©2024WebsitePlanet.com.AllRightsReserved. varvm_js_erros=[];window.addEventListener("error",function(event){console.log(event.error);vm_js_erros.push({messe:event.error,file:event.filename,line:event.lineno});});(function(w,d){vardatadog_logger_inited=false;functiondatadog_logger_init(){if(datadog_logger_inited){return;}datadog_logger_inited=!0;DD_LOGS.init({clientToken:'pubae90c910f262c6aa7ef8bb5c378',forwardErrorsToLogs:true,});for(varN=0;N

Local:Como construir um site em 2022: Guia Passo a Passo CompletoRelatório

Se houver uma violação do site, clique em DenunciarRelatório

Informação recomendada

Site recomendado