Ásia - Insider

  • 2022-01-02Data de coleta
  • 2022-02-15Atualizada
Ásia - Insider

nome do domínio:www.businessinsider.comAvaliação

cerca de 1000~20000

nome do domínio:www.businessinsider.comfluxo

197

nome do domínio:www.businessinsider.comBom ou mal

Ótimo espetáculo. Pode ser bem sucedido Ji uma prosperidade e um declínio. labuta em vão

local na rede Internet:Ásia - InsiderPesos

2

local na rede Internet:Ásia - InsiderIP

151.101.1.171

local na rede Internet:Ásia - Insidercontente

BusinessInsiderwindow.Fenrir={"config":{"ads":{"providerName":"dfp","sticky_active_header_height":47,"abTest":{"lazyLoad":155,"adxABTest":19,"changeCorrelator":false},"continentCode":"NA","config":{"scrollVelocity":false,"refreshAdsTimeout":30,"refreshAdsDisplayTimer":false},"data":{"networkid":,"verity":{}},"services":{"amazonTam":{"enabled":true,"pubID":3201,"adServer":"googlet"},"rubiconPrebid":{"enabled":true,"scriptUrl":"ads.rubiconproject.com/prebid/.js","gdprScriptUrl":"ads.rubiconproject.com/prebid/_gdpr.js"},"indexExchange":{"enabled":false},"permutive":{"enabled":true,"projectId":"3aba5292-ba75-422b-8715-bdf7836","publicKey":"6f1150a7-e587-49c6-b439-a4b7ee68a5a7","version":1},"doubleverify":{"enabled":true}},"meta":{"primaryVertical":"homepe","categories":"","secondaryVerticals":"","author":"","peType":"homepe","adunit":{"site":"businessinsider","variation":"homepe","vertical":"_homepe","regionCounter":{"desktop":{},"mobile":{}},"rawVertical":false}}},"authEnv":"production","fenrirEnv":"production","authentication":{"url":"account.businessinsider.com","redirectAuth":{"url":"auth.businessinsider.com/authorize?response_type=code&client_id=__AUTH-CLIENT-ID__&redirect_uri=__REDIRECT-URI__&state=__UNIQUE-ID__&connection=__CONNECTION-NAME__&scope=openid%20offline_access","key":"1kovu25q4Q11Fx1x1mIKn0Fas5VS2a"},"clientId":"faf5a910-46c1-47fd-a19a-ab","recaptcha":{"siteKey":"6Lc34KYZAAAAALr41Qa1RN3K06SrpQTbrN2_WTdh","siteKeyInvisible":"6LeGf2QhAAAAABuMypNcSm7aU69j1kGyUPzEF2L0","activeAt":["create-account-password","restore-password","restore-password-set-new-password","reg-wall-create-account-password","reg-wall-create-account-password-abtest","corp-subs-create-account-password","consumer-subs-checkout-restore-password","consumer-checkout-frictionless-restore-password"]}},"newsletterSignUp":"account.businessinsider.com/newsletter","newsletterEnv":"production","consentManement":{},"piano":{"providerName":"piano","domain":"businessinsider","subdomain":"www","rid":"RK195MO","isUser":false,"isAdmin":false,"isAnon":true,"contentCreated":"","contentAuthor":"","contentSection":"homepe","verticalData":{"primaryVertical":"homepe","secondary":[""]},"paywallState":"","categories":[],"subscriptionResources":{"isProd":true,"holidayOffer":{"offerId":"OFHIX8B0MB4T","plansToSubscribeTo":{"usd":{"annual":"TM7C8A6RZIEV"},"cad":{"annual":"TME2IXKXDG0N"},"gbp":{"annual":"TM4YKGAXJLVG"}}},"onboarding-annual-upgrade":{"offerId":"OFHIX8B0MB4T","plansToSubscribeTo":{"usd":{"annual":"TMTZ9FRS25EZ"},"cad":{"annual":"TMO7V4ZPMP4X"},"gbp":{"annual":"TM3N2ODZ4U3A"}}},"onboarding-annual-49-upgrade":{"offerId":"OFHIX8B0MB4T","plansToSubscribeTo":{"usd":{"annual":"TMPIP6MGL8H8"},"cad":{"annual":"TMJH2IH9CL0V"},"gbp":{"annual":"TMWKUTKS51FC"}}},"cancellation-monthly-upgrade":{"offerId":"OFHIX8B0MB4T","plansToSubscribeTo":{"usd":{"monthly":"TME2UHDOE3WL"},"cad":{"monthly":"TMC1UHEXRDJL"},"gbp":{"monthly":"TMQZIDG8DR1E"}}},"renewal-off-annual":{"plansToSubscribeTo":{"usd":{"annual":"TM7C8A6RZIEV"},"cad":{"annual":"TME2IXKXDG0N"},"gbp":{"annual":"TM4YKGAXJLVG"}}},"renew-59-annual":{"offerId":"OFHIX8B0MB4T","plansToSubscribeTo":{"usd":{"annual":"TMIV4169Y8MW"}}},"renew-69-annual":{"offerId":"OFHIX8B0MB4T","plansToSubscribeTo":{"usd":{"annual":"TMHJ9A93F1F4"}}},"renew-79-annual":{"offerId":"OFHIX8B0MB4T","plansToSubscribeTo":{"usd":{"annual":"TMTZ9FRS25EZ"}}},"renew-89-annual":{"offerId":"OFHIX8B0MB4T","plansToSubscribeTo":{"usd":{"annual":"TM5WX7ZAN120"}}},"renew-995-monthly":{"offerId":"OFHIX8B0MB4T","plansToSubscribeTo":{"usd":{"monthly":"TMVOJV2KK148"}}},"renewal-annual39":{"plansToSubscribeTo":{"usd":{"annual":"TMD3HSEA69BS"}}},"annual-offer":{"offerId":"OFNBQNWJFOV1","termId":"TMUCHFTZTQFZ"},"30guest":{"offerId":"OFC9XIQNOD4X","termId":"TMUWDFMAZYRA"},"discount":{"offerId":"OFWOUDU6D0W3","termId":{"1year":"TMH19UHB5D6Z"}},"plansNotToShowRetentionOffer":["TMG6CJPC4C7D","TM9D0EMB8J6L","TMHJ9A93F1F4","TM0QWC75RERG","TMJ4RF5LWVJ4","TMGAA1A26FMW","TMTZ9FRS25EZ","TMTFJZJ","TMMBUEIYMAIE","TMWKUTKS51FC","TMJH2IH9CL0V","TMPIP6MGL8H8","TMOJHRR9XIXY","TM0I2DLUM3BN"],"upgradeSubscriptionPlansTo":{"monthly-offer1":{"usd":"TMG5S0487LZ3","cad":"TMAC6FIOUTGZ","gbp":"TMOEIY8BJ4X9"},"monthly-offer495":{"usd":"TMSUTOJTV6EX","cad":"TMCGM4KI4A7S","gbp":"TM4U9OZQ6NL3"}},"preCancellationOffer":{"usd":{"term":"TM7C8A6RZIEV","currencySymbol":"$","renewalPrice":"$99","offerPrice":"29"},"cad":{"term":"TME2IXKXDG0N","currencySymbol":"C$","renewalPrice":"C$99","offerPrice":"29"},"gbp":{"term":"TM4YKGAXJLVG","currencySymbol":"£","renewalPrice":"£79","offerPrice":"24"}}}},"stripe":{"subscriptionResources":{"renewal-off-annual":{"plansToSubscribeTo":{"usd":{"annual":"f69f772f-a2c8-4768-ad1d-f386"}}},"cancellation-annual-upgrade":{"usd":{"planId":"fb7506b9-570f-4b03-ab0b-c0baac1e46b0","currencySymbol":"$","renewalPrice":"149","offerPrice":"49","monthlyPrice":"25.95","interval":"yearly"},"cad":{"planId":"c12e3e69-0e64-4a8b-81c4-056c9f92dfa4","currencySymbol":"C$","renewalPrice":"199","offerPrice":"59","monthlyPrice":"14.95","interval":"yearly"},"gbp":{"planId":"810be99a-d57c-4c03-b0b6-ea4b9b5e5f00","currencySymbol":"£","renewalPrice":"119","offerPrice":"39","monthlyPrice":"10","interval":"yearly"}},"annual-early-renewal":{"usd":{"planId":"7e87ae59-0c53-436e-b6f3-72f2cb117e25","currencySymbol":"$","renewalPrice":"99","offerPrice":"69"},"cad":{"planId":"89f953cf-ebf2-4353-8f74-6c15d4ecf3c9","currencySymbol":"C$","renewalPrice":"99","offerPrice":"69"},"gbp":{"planId":"3120f175-7e06-4ada-b844-5bb26f7c5f53","currencySymbol":"£","renewalPrice":"79","offerPrice":"55"}},"annual-switch":{"usd":{"planId":"92ef4403-b84d-421f-abca-a8ec85b9c71d","currencySymbol":"$","renewalPrice":"149","offerPrice":"39","interval":"yearly"},"cad":{"planId":"7c0d5e2d-901a-4e42-9194-4219a","currencySymbol":"C$","renewalPrice":"179","offerPrice":"49","interval":"yearly"},"gbp":{"planId":"afb-4803-4b6b-adab-96be54b","currencySymbol":"£","renewalPrice":"105","offerPrice":"29","interval":"yearly"}},"onboarding-annual-49-upgrade":{"plansToSubscribeTo":{"usd":{"annual":"f69f772f-a2c8-4768-ad1d-f386"}}},"preCancellationOffer":{"usd":{"planId":"fb7506b9-570f-4b03-ab0b-c0baac1e46b0","currencySymbol":"$","renewalPrice":"149","offerPrice":"49","monthlyPrice":"25.95","interval":"yearly"},"cad":{"planId":"c12e3e69-0e64-4a8b-81c4-056c9f92dfa4","currencySymbol":"C$","renewalPrice":"199","offerPrice":"59","monthlyPrice":"14.95","interval":"yearly"},"gbp":{"planId":"810be99a-d57c-4c03-b0b6-ea4b9b5e5f00","currencySymbol":"£","renewalPrice":"119","offerPrice":"39","monthlyPrice":"10","interval":"yearly"}},"blackFriday2022":{"usd":{"annual":"24e23f5d-d40e-410d-c256a72","annualAdFree":"c6-0b08-40e5-865f-6a3ae14d04eb"}},"plansNotToShowRetentionOffer":[]}},"idun":"membership-api.businessinsider.com","skadi":"membership-api.businessinsider.com","forsetiUrl":"my.businessinsider.com","basicAuth":{"domain":"membership-api.businessinsider.com","apiKey":"OGU5ZWUyZWUtNjM2ZS00OTdiLWI0OTUtYTliOGIzMjQ1ODA2"},"tracking":{"providerName":["ga","t","comscore"],"base_url":"//","postTrackingObject":{"peType":"homepe","postID":null,"postURI":"homepe","publisher":"","editor":null,"vertical":"homepe","verticals":[],"author":"","category":"","dateModified":false,"datePublished":false,"createUser":null,"numSlides":0,"wordCount":0,"abTest":"|pb_5:control|sicr:v|","splitTest":null,"secondaryVerticals":"","pÁsia - InsideraywallState":null,"theme":""},"data":{"gtm":{"id":"GTM-NS64GV","env_string":""},"domains":["businessinsider.com","insider.com"],"t":{"pixel":"i.businessinsider.com/t.gif"}}},"logging":true,"abTests":[{"name":"pb_5","value":"control"},{"name":"sicr","value":"v"}],"featureFls":{"shouldConsentDialogAutoClose":false,"disablePrebidRubicon":false,"disableAllAbTests":false,"activityLogging":false,"logs":false,"forceSpeedcurveSample":false,"forceDataDogRumSample":false,"disableDataDogRumSample":false,"forceDataDogLogs":false,"disableDataDogLogs":false,"unified":false,"trending":false,"developerBar":false,"changeCorrelator":false,"adFree":false,"renderTicker":false,"appSoftLaunch":false,"ignoreRedirect":false,"lcpPerformanceShowcase":false,"ampMarquee":false,"removeTickerHubN":false,"storyVersioningApi":false,"testLatestSharedComponents":false,"myInsiderCorporate":false,"utmContentMarketing":false,"ampAdConsent":false,"ampAdConsentPurposes":false,"webVitals":false,"isPersonalizedOffer":false,"sponsorshipMode":false},"sticky":{"siteSkinEnabled":false,"stickyActiveHeaderHeaderHeight":71,"subnStickyAdBuffer":250},"dataLayer":{"peType":"homepe","postURI":"homepe","publisher":"","vertical":"homepe","author":"","category":"","dateModified":false,"datePublished":false,"abTest":"|pb_5:control|sicr:v|","secondaryVerticals":"","theme":""},"shouldDeferScripts":true,"shouldManeConsent":true,"delayThirdPartyScripts":false,"facets":{"url":"","path":"","site":"","type":"","vertical":"","categories":[],"components":[],"shortcodes":[],"embeds":[]},"embedConfig":{},"datadogProxyUrl":"/ajax/dd","subscribeEnabled":true,"name":"BusinessInsider","domain":"businessinsider","twitter":"businessinsider","linkedIn":"businessinsider","youtube":"@InsiderBusiness","instram":"insiderbusiness","resourceName":"bi","identifier":"bi","targetingName":"business-insider","adUnitSite":"businessinsider","assetsPath":"BI","s3Directory":"us","searchIdentifier":"businessinsider.com","color":"#ffffff","gtmId":"GTM-NS64GV","gaId":"UA--6","ampGtmId":"GTM-MVJQ7ZG","ampGaId":"UA--6","popularModule":{"title":"Popularwithsubscribers","section":"prime","tracking":"r=rr"},"fbContentId":"070","fbAudienceNetworkdId":"","fbGTMId":"GTM-P8G4HM","appleItunesAppId":"6","description":"BusinessInsidertellstheglobaltech,finance,markets,media,healthcare,andstrategystoriesyouwanttoknow.","pianoRid":"RK195MO","verticalLabelMapping":{"lifestyle":"ExecutiveLifestyle","biintelligence":"BusinessInsiderIntelligence","binews":"News","techinsider":"Tech","prime":"Premium","biprime":"Premium","wuhancoronirus":"coronirus","beauty(reviews)":"Beauty","deals(reviews)":"Deals","education(reviews)":"Education","tech(reviews)":"Tech","fitness(reviews)":"Fitness","gifts(reviews)":"Gifts","health(reviews)":"Health","home(reviews)":"Home","kitchen(reviews)":"Kitchen","outdoors(reviews)":"Outdoors","parenting(reviews)":"Parenting","pets(reviews)":"Pets","streaming(reviews)":"Streaming","style(reviews)":"Style","trel(reviews)":"Trel","learning(reviews)":"Learning","hobbies&crafts(reviews)":"Hobbies&Crafts","diet&nutrition(reference)":"Diet&Nutrition","investing(reference)":"Investing","economics&markets(reference)":"Economics&Markets","investmentassets(reference)":"InvestmentAssets","investmentaccounts(reference)":"InvestmentAccounts","investingstrategies(reference)":"InvestingStrategies","professionals&advisors(reference)":"Professionals&Advisors","laptops&tablets(reference)":"Laptops&Tablets","gadgets(reference)":"Gadgets","gaming(reference)":"Gaming","smarthome(reference)":"SmartHome","smartphones(reference)":"Smartphones","software&apps(reference)":"Software&Apps","streaming(reference)":"Streaming"},"partials":{"footer-brand-logos":"footer-brand-logos"},"rubicon":{"siteId":"","mobileStickyLower":"-320x50","mobileInPost":"-300x250"},"dynamicEnabled":true,"socialLinks":{"facebook":"/businessinsider","twitter":"twitter.com/businessinsider","instram":"/insiderbusiness/","youTube":"/user/businessinsider","linkedIn":"/company/businessinsider/"},"masthead":{"searchLink":"/s","subscribeButtonLink":"/subscription?IR=C"},"crossDomainAuth":{"mi":"markets.businessinsider.com"},"unlockedExperiences":{},"subdomain":"www","bylineNoShows":["insider","businessinsider","businessinsideruk"],"components":{"back-to-home":{"display":{"postPe":true,"showPe":true},"content":{"default":{"link":"/","text":"HOMEPE"},"video":{"link":"/video","partial":"icons/n-video","subClass":"video-masthead-logo"}}},"live-updates":{"homepeDisplay":true,"postPeDisplay":true,"templatePath":"live-updates/template","subClass":"live-updates-container","showOnCommerce":false,"postPeVerticals":["tech","finance","markets","strategy","retail","advertising","healthcare"]},"my-insider":"","share":{"byline":{"shareOptions":["facebook","email","twitter","linkedin","copylink"]}},"subscription-corporate/seats-card":{"api":{"domain":"membership-api.businessinsider.com","apiKey":"OGU5ZWUyZWUtNjM2ZS00OTdiLWI0OTUtYTliOGIzMjQ1ODA2"},"plan":"3fe932aa-1d63-45d6-9e84-8ba2f1aaea21"},"vendor-taboola":{"taboolaLoader":"//cdn.taboola.com/libtrc/businessinsider/loader.js","postBottom":{"desktop":{"id":"taboola-below-main-column","mode":"thumbs-1r","placement":"below-main-column","targetType":"mix","onlyOn":"desktop"},"mobile":{"id":"taboola-below-article","mode":"thumbs-2r-mobile","placement":"BelowArticleThumbnailsMobile","targetType":"mix","onlyOn":"mobile"}},"referenceLibraryPostBottom":{"desktop":{"id":"taboola-below-article-thumbnails---reference-pe","mode":"thumbs-1r","placement":"BelowArticleThumbnails-ReferencePe","targetType":"mix","onlyOn":"desktop"},"mobile":{"id":"taboola-below-article-thumbnails---reference-pe---mobile","mode":"thumbs-2r-mobile","placement":"BelowArticleThumbnails-ReferencePe-Mobile","targetType":"mix","onlyOn":"mobile"}},"migratedPostBottom":{"desktop":{"id":"taboola-below-article-thumbnails---insider","mode":"thumbs-feed-01-new","placement":"BelowArticleThumbnails-Insider","targetType":"mix","onlyOn":"desktop"},"mobile":{"id":"taboola-below-article-thumbnails-mobile---insider","mode":"thumbs-feed-01-new","placement":"BelowArticleThumbnailsMobile-Insider","targetType":"mix","onlyOn":"mobile"}},"premiumPostBottom":{"desktop":{"id":"taboola-below-article-thumbnails---paywall-content","mode":"alternating-thumbnails-a","placement":"BelowArticleThumbnails-PaywallContent","targetType":"mix","onlyOn":"desktop"},"mobile":{"id":"taboola-below-article-thumbnails-mobile---paywall-content","mode":"alternating-thumbnails-a","placement":"BelowArticleThumbnailsMobile-PaywallContent","targetType":"mix","onlyOn":"mobile"}}}},"componentsToLoad":{},"adsTxtDir":"/us/ads.txt","shareButtons":{"topBarShareButtons":["twitter","linkedin","flipboard","facebook","email","copylink"],"videoShareButtons":{"primary":["share-dropdown","facebook","email"],"secondary":["twitter","linkedin","flipboard","copylink"]}},"rubiconAmp":{"amp":{"business":{"siteId":"","stickyLower":"-320x50","inPost":"-300x250"},"life":{"siteId":"","stickyLower":"-320x50","inPost":"-300x250"},"news":{"siteId":"","stickyLower":"-320x50","inPost":"-300x250"},"default":{"siteId":"","stickyLower":"-320x50","inPost":"-300x250"}}},"zendesk":{"chatKey":"76a7a72c-2c9b-455e-b822-8cb01a97e60d"},"trackingAnalyticName":"LiveElectionFeed","notificationBanner":{"type":"","data":{"copyTitle":"","copy":"","cta":""},"defaultState":"active","maxViews":false,"defaultClass":"d-md-noneactive","disallowInApp":true,"gaEvent":"","gaEventCategory":""},"topNotice":{"targetBrowsers":["MSIE","Trident"],"targetCategories":["pfi-tpg"],"data":{"copy":"Hmm...Itlookslikeyou’reusinganoutdatedorunsupportedbrowserthatmaynotrendercorrectly.Forthebestexperience,werecommendusingthelatestversionofGoogleChrome,Safari,MicrosoftEdge,orFirefox"}},"bifrost":{"production":"bifrost-bfp.pes.dev","development":"sting.bifrost-bfp.pes.dev"},"sharedRecaptcha":{"V2SiteKey":"6Lc34KYZAAAAALr41Qa1RN3K06SrpQTbrN2_WTdh","V2SiteKeyInvisible":"6LeGf2QhAAAAABuMypNcSm7aU69j1kGyUPzEF2L0"},"gtmIdGA4":"GTM-MP6F46L","jwPlayer":{"hero":"puACk8ZV","nowWatch":"P0a1LFN5","inPost":"rpoASVKQ","playlist":"Vtl6VSDD","featuredVideo":"JoOudDws"},"recommendationsPlaylist":{"ins":"TXrojpv3","bi":"4yvN3aI1"},"errorSearch":{"action":"/s","name":"q"},"editions":[{"country":"Deutschland&Österreich","url":"http?IR=C","abbr":"AT"},{"country":"Deutschland","url":"httpbusinessinsider.de?IR=C","abbr":"DE","footerOnly":true},{"country":"España","url":"httpbusinessinsider.es","abbr":"ES"},{"country":"India","url":"http","abbr":"IN"},{"country":"Japan","url":"http","abbr":"JP"},{"country":"México","url":"http","abbr":"MX"},{"country":"Netherlands","url":"http?IR=C","abbr":"NL"},{"country":"Polska","url":"http/?IR=C","abbr":"PL"}],"validDomains":["insider.com","businessinsider.com","insider.engineering","forseti.pes.dev","my.businessinsider.com","localhost"],"formSubmit":{"corporateLanding":{"sender":"support@businessinsider.com","receivers":["group-subscriptions@businessinsider.com"],"subject":"GroupSubscriptions-Over60Seats"},"marketo":{"url":"867-slg-901.mktorest.com","clientId":"417f29a9-764c-4e34-8fd9-f518e","clientSecret":"6uNayH5PafSNnza7JAjARxCtTz9lVcHm"}},"doubleVerifyCodes":{"dvClientCode":"","dvSettingsCode":"DV"},"validCategoryVariables":["Category_BIPrimeArchive","Category_BIPrime","Category_FBPA","Category_BIIntelligence","Category_Video","Category_Features"],"appsFlyer":{"oneLink":"insider-app.onelink.me/4cpG"}},"id":"homepe","meta":{"sections":[{"type":"vertical","id":"tech","attributes":{"created":"2023-11-27T23:49:48.065Z","label":"Tech","modified":"2023-11-27T23:49:48.065Z"},"links":{"posts":"capi-varnish.aws.businessinsider.com/v1/bi/verticals/tech/posts","self":"capi-varnish.aws.businessinsider.com/v1/bi/verticals/tech","site":"/tech"}},{"type":"vertical","id":"markets","attributes":{"created":"2023-11-27T23:54:18.792Z","label":"Markets","modified":"2023-11-27T23:54:18.792Z"},"links":{"posts":"capi-varnish.aws.businessinsider.com/v1/bi/verticals/markets/posts","self":"capi-varnish.aws.businessinsider.com/v1/bi/verticals/markets","site":"/markets"}},{"type":"vertical","id":"discourse","attributes":{"created":"2022-12-05T15:00:20.786Z","description":"Throughthought-provokingperspectivesinformedbyanalysis,reporting,andexpertise,Discoursejournalismexploresandilluminatesthemostfascinatingissuesandideasoftoday.","label":"Discourse","modified":"2022-12-05T15:00:20.786Z"},"links":{"posts":"capi-varnish.aws.businessinsider.com/v1/bi/verticals/discourse/posts","self":"capi-varnish.aws.businessinsider.com/v1/bi/verticals/discourse","site":"/discourse"}},{"type":"vertical","id":"finance","attributes":{"created":"2023-11-27T23:50:45.796Z","description":"WhatYouWantToKnowAboutWallStreet","label":"Finance","modified":"2024-04-16T15:23:54.434Z"},"links":{"posts":"capi-varnish.aws.businessinsider.com/v1/bi/verticals/finance/posts","self":"capi-varnish.aws.businessinsider.com/v1/bi/verticals/finance","site":"/finance"}},{"type":"vertical","id":"yourmoney","attributes":{"created":"2011-09-08T00:00:00Z","description":"GettheBusinessInsidertakeandcomparethebestsingsaccounts,bestcreditcards,bestinsurancepolicies,andmore.Neverfeellikeafinancialoutsiderain.","label":"PersonalFinance","modified":"2024-01-02T18:09:41.19Z"},"links":{"posts":"capi-varnish.aws.businessinsider.com/v1/bi/verticals/yourmoney/posts","self":"capi-varnish.aws.businessinsider.com/v1/bi/verticals/yourmoney","site":"/yourmoney"}},{"type":"vertical","id":"insiderpicks","attributes":{"created":"2015-04-27T20:46:37.279Z","description":"In-depthreviews,how-toguidesandbuyingadvicefromtrustedexpertswho’vetestedthousandsofproductsfortech,streaming,health,kitchen,home,pets,beautyandstyle.","label":"Reviews","modified":"2023-01-18T15:23:10.131Z"},"links":{"posts":"capi-varnish.aws.businessinsider.com/v1/bi/verticals/insiderpicks/posts","self":"capi-varnish.aws.businessinsider.com/v1/bi/verticals/insiderpicks","site":"/insiderpicks"}}],"isReviews":false,"isHelpfulness":false,"isSuperVertical":true,"isPersonalFinance":false,"isReferenceSubVertical":false,"hasLandingPeStickyFooterAd":true,"dateOfLastModifiedPost":"2024-04-18T15:31:40Z","disableTimestamps":true,"excludePremiumTs":true,"trackingType":"","isHomepeVertical":false,"strategyForLoadingSubcategories":"default-vertical"},"path":"/","subType":"homepe","superVertical":"business","type":"vertical","continentCode":"NA","deviceType":"desktop","env":"production"}||{"config":{}};window.Fenrir.cmd=window.Fenrir.cmd||[];window.Fenrir=window.Fenrir||{"config":{}};;(function(w,o,d){w[o]=w[o]||function(){w[o][d].push(arguments)};w[o][d]=w[o][d]||[]})(window,'Osano','data');LUX=function(){vare="undefined"!=typeofLUX&&void0!==LUX.gaMarks?LUX.gaMarks:[],n="undefined"!=typeofLUX&&void0!==LUX.gaMeasures?LUX.gaMeasures:[],t="LUX_start",r=window.performance,a="undefined"!=typeofLUX&&LUX.ns?LUX.ns:Date.now?Date.now():+newDate;functionu(){if(r){if(r.now)returnr.now();if(r.webkitNow)returnr.now();if(r.msNow)returnr.now();if(r.mozNow)returnr.now()}return(Date.now?Date.now():+newDate)-a}functiono(n){returnfunction(e,n){for(i=n.length-1;i>=0;i--){vart=n[i];if(e===t.name)returnt}return}(n,function(){if(r){if(r.getEntriesByType)returnr.getEntriesByType("mark");if(r.webkitGetEntriesByType)returnr.webkitGetEntriesByType("mark")}returne}())}returnr&&r.timing&&r.timing.nigationStart&&(a=r.timing.nigationStart),{mark:function(n){if(r){if(r.mark)returnr.mark(n);if(r.webkitMark)returnr.webkitMark(n)}e.push({name:n,entryType:"mark",startTime:u(),duration:0})},measure:function(e,i,a){if(void0===i&&o(t)&&(i=t),r){if(r.measure)returni?a?r.measure(e,i,a):r.measure(e,i):r.measure(e);if(r.webkitMeasure)returnr.webkitMeasure(e,i,a)}varf=0,s=u();if(i){varm=o(i);if(m)f=m.startTime;else{if(!(r&&r.timing&&r.timing[i]))return;f=r.timing[i]-r.timing.nigationStart}}if(a){varw=o(a);if(w)s=w.startTime;else{if(!(r&&r.timing&&r.timing[a]))return;s=r.timing[a]-r.timing.nigationStart}}n.push({name:e,entryType:"measure",startTime:f,duration:s-f})},gaMarks:e,gaMeasures:n}}(),LUX.ns=Date.now?Date.now():+newDate,LUX.ac=[],LUX.cmd=function(e){LUX.ac.push(e)},LUX.init=function(){LUX.cmd(["init"])},LUX.send=function(){LUX.cmd(["send"])},LUX.addData=function(e,n){LUX.cmd(["addData",e,n])};LUX.label="homepe";//PeType:homepe,story,slideshow,video,hubpe,etc.LUX.minMeasureTime=7000;LUX.maxMeasureTime=;LUX.sendBeaconOnPeHidden=true;//SetthistotruewhennotinautofiremodeLUX.auto=false;//WewillmanuallyfireonceGDPRscriptsheloaded(consent-handler.js)//CustomDimensionsLUX.addData('siteName','BusinessInsider');LUX.addData('continentCode','NA');LUX.addData('premium','notapplicable');//Wecan'tcallLUX.forceSampleuntiltheAPIisonthepewindow.Fenrir.sampleSpeedcurve=functionsampleSpeedcurve(){if(window.LUX?.forceSample&&window.Fenrir?.config?.featureFls?.forceSpeedcurveSample){window.LUX.forceSample();}}(function(){vartoFirstRequest='InlineScriptsInit-Start';vartoAdLibrary='InlineScriptsAdLibraryLoaded-Start';functioncreateMark(markName){varperfMarks=window.performance;varlux=window.LUX;if(perfMarks&&perfMarks.clearMarks&&perfMarks.mark){perfMarks.clearMarks(markName);perfMarks.mark(markName);}elseif(lux&&lux.mark){lux.mark(markName);}}createMark(toFirstRequest);createMark(toAdLibrary);})()tp=window['tp']||[];/***Font-familydeclarations**99%ofthetimeyouwon'tneedtoaddyourselectorhere.*ReadtheFenrirWikiabouthowtoworkwithfonts:*github.com/businessinsider/fenrir/wiki/CSS-Fonts*/.headline-regular/*utilityclass*/{font-family:Helvetica,Arial,sans-serif;font-weight:400;font-style:normal;}h1,h2,h3,h4,h5,h6,.typographyh1strong:not(.ignore-typographystrong),.typographyh2strong:not(.ignore-typographystrong),.typographyh3strong:not(.ignore-typographystrong),.typographyh4strong:not(.ignore-typographystrong),.typographyh5strong:not(.ignore-typographystrong),.typographyh6strong:not(.ignore-typographystrong),.typography.summary-list,.typography.summary-listli,.typography.summary-liststrong,.typography.read-more-linksli:first-child,.typography.read-more-linksli:first-childstrong,.is-enhanced.typographyp.drop-cap::first-letter,/*TODO:Usetheutilityclassinsteadofelementselectors*/.typography.featured-toutolli,.headline-bold/*utilityclass*/,.headline-bold.ignore-typography/*utilityclass*/{font-family:Helvetica,Arial,sans-serif;font-weight:900;font-style:normal;}.typographyh1em:not(.ignore-typographyem),.typographyh2em:not(.ignore-typographyem),.typographyh3em:not(.ignore-typographyem),.typographyh4em:not(.ignore-typographyem),.typographyh5em:not(.ignore-typographyem),.typographyh6emÁsia - Insider:not(.ignore-typographyem),.typography.summary-listliem,/*TODO:Usetheutilityclassinsteadofelementselectors*/.typography.featured-toutolem,.headline-bold-italic/*utilityclass*/{font-family:Helvetica,Arial,sans-serif;font-weight:900;font-style:italic;}.typography:not(.ignore-typography),/*TODO:Usetheutilityclassinsteadofelementselectors*/.typography.ecm.summary-listli,.body-regular/*utilityclass*/{font-family:Georgia,Times,serif;font-weight:400;font-style:normal;}.typography.blockquote{font-family:Georgia,Times,serif;font-weight:400;font-style:italic;}/*TODO:Usetheutilityclassinsteadofelementselectors*/.category-tlinep,.typographyem:not(.ignore-typographyem),.body-italic/*utilityclass*/{font-family:Georgia,Times,serif;font-weight:400;font-style:italic;}.typographystrong:not(.ignore-typographystrong),.body-bold/*utilityclass*/{font-family:Georgia,Times,serif;font-weight:600;font-style:normal;}.typographyemstrong:not(h2*):not(h3*):not(h4*):not(h5*):not(h6*):not(.ignore-typographystrong),.typographystrong:not(h2*):not(h3*):not(h4*):not(h5*):not(h6*):not(.ignore-typographystrong)em,.body-bold-italic/*utilityclass*/{font-family:Georgia,Times,serif;font-weight:600;font-style:italic;}window.initialDataLayer={"peType":"homepe","postURI":"homepe","publisher":"","vertical":"homepe","author":"","category":"","dateModified":false,"datePublished":false,"abTest":"|pb_5:control|sicr:v|","secondaryVerticals":"","theme":""};{"@context":"httpschema.org","@type":"CollectionPe","url":"","description":"BusinessInsidertellstheglobaltech,finance,markets,media,healthcare,andstrategystoriesyouwanttoknow.","name":"BusinessInsider","ime":"/public/assets/logos/structured-data.png","mainEntity":{"@context":"httpschema.org","@type":"ItemList","itemListElement":[{"@context":"httpschema.org","@type":"ListItem","url":"/trump-trial-prosecutors-want-sanctions-truth-social-attack-prospective-jurors-2024-4","position":1},{"@context":"httpschema.org","@type":"ListItem","url":"/meghan-markle-prince-harry-new-netflix-shows-suits-spotify-deal-2024-4","position":2},{"@context":"httpschema.org","@type":"ListItem","url":"/data-centers-electricity-consumers-discounts-utilities-2024-4","position":3},{"@context":"httpschema.org","@type":"ListItem","url":"/microsoft-gpu-targets-1-8-million-ai-chips-this-year-2024-4","position":4},{"@context":"httpschema.org","@type":"ListItem","url":"/where-tesla-elon-musk-slashing-jobs-buffalo-new-york-2024-4","position":5},{"@context":"httpschema.org","@type":"ListItem","url":"/olivia-munn-double-mastectomy-breast-cancer-body-ime-emotions-2024-4","position":6},{"@context":"httpschema.org","@type":"ListItem","url":"/tesla-stock-price-analyst-ratings-targets-forecasts-downgrades-wall-street-2024-4","position":7},{"@context":"httpschema.org","@type":"ListItem","url":"/get-colonoscopy-colon-cancer-symptoms-colorectal-oncologist-2024-4","position":8},{"@context":"httpschema.org","@type":"ListItem","url":"/best-things-trader-joes-chef-family-of-three-grocery-list-2024-4","position":9},{"@context":"httpschema.org","@type":"ListItem","url":"/royal-caribbean-icon-of-the-seas-cruise-budget-upgrades-lobster-2024-4","position":10},{"@context":"httpschema.org","@type":"ListItem","url":"/best-european-cities-according-to-frequent-treler-2024-4","position":11},{"@context":"httpschema.org","@type":"ListItem","url":"/hermes-b-collectors-birkin-kelly-purse-2024-4","position":12},{"@context":"httpschema.org","@type":"ListItem","url":"/fed-rate-cuts-delay-powell-inflation-economy-money-monetary-policy-2024-4","position":13},{"@context":"httpschema.org","@type":"ListItem","url":"/which-house-democrats-vote-ainst-resolution-condemning-iran-attack-israel-2024-4","position":14},{"@context":"httpschema.org","@type":"ListItem","url":"/ural-scraps-plan-to-rescue-a320-ditched-in-russian-field-2024-4","position":15},{"@context":"httpschema.org","@type":"ListItem","url":"/review-comparing-terry-blacks-and-franklin-barbecue-2024-4","position":16},{"@context":"httpschema.org","@type":"ListItem","url":"/middle-class-americans-earning-above-poverty-live-paycheck-to-paycheck-2024-4","position":17},{"@context":"httpschema.org","@type":"ListItem","url":"/chinas-newest-aircraft-carrier-seen-with-aircraft-mock-ups-imes-2024-4","position":18},{"@context":"httpschema.org","@type":"ListItem","url":"/personal-finance/15-year-refinance-rates","position":19},{"@context":"httpschema.org","@type":"ListItem","url":"/personal-finance/overdraft-fees-vs-nsf-fees","position":20},{"@context":"httpschema.org","@type":"ListItem","url":"/donald-trump-hush-money-trial-juror-worried-identity-being-revealed-2024-4","position":21},{"@context":"httpschema.org","@type":"ListItem","url":"/personal-finance/ninjatrader-review","position":22},{"@context":"httpschema.org","@type":"ListItem","url":"/instacart-adding-miles-to-seattle-deliveries-gig-work-pay-law-2024-4","position":23},{"@context":"httpschema.org","@type":"ListItem","url":"/companies-software-legal-tricks-subscriptions-customers-money-pay-death-ownership-2023-5","position":24},{"@context":"httpschema.org","@type":"ListItem","url":"/love-is-blind-netflix-cast-reality-show-dating-mental-health-2023-4","position":25},{"@context":"httpschema.org","@type":"ListItem","url":"/credit-card-phone-theft-sim-swap-identity-theft-investigation-2023-4","position":26},{"@context":"httpschema.org","@type":"ListItem","url":"/home-prices-not-dropping-warns-zillow-economist-2023-4","position":27},{"@context":"httpschema.org","@type":"ListItem","url":"/rivian-buyer-car-died-in-snow-after-3-year-wait-2023-3","position":28},{"@context":"httpschema.org","@type":"ListItem","url":"/tech-companies-ruining-apps-websites-internet-worse-google-facebook-amazon-2023-3","position":29},{"@context":"httpschema.org","@type":"ListItem","url":"/taylor-swift-eras-tour-guide-to-every-album-era-2022-12","position":30},{"@context":"httpschema.org","@type":"ListItem","url":"/real-estate-ent-not-need-for-buying-home-2024-4","position":31},{"@context":"httpschema.org","@type":"ListItem","url":"/guides/style/best-dresses-on-amazon","position":32},{"@context":"httpschema.org","@type":"ListItem","url":"/mistral-raising-new-round-up-to-2-billion-2024-4","position":33},{"@context":"httpschema.org","@type":"ListItem","url":"/read-pitch-deck-creator-startup-storierse-raise-2-5-million-2024-4","position":34},{"@context":"httpschema.org","@type":"ListItem","url":"/stock-market-today-fed-rate-cuts-williams-bostic-earnings-tech-2024-4","position":35},{"@context":"httpschema.org","@type":"ListItem","url":"/boeing-whistleblower-alleges-criminal-coverup-over-737-max-blowout-2024-4","position":36},{"@context":"httpschema.org","@type":"ListItem","url":"/colorado-signs-bill-protect-privacy-rights-neurotechnology-neuralink-musk-2024-4","position":37},{"@context":"httpschema.org","@type":"ListItem","url":"/polyamorous-couple-used-ile-scrum-to-improve-communication-jealousy-2024-4","position":38},{"@context":"httpschema.org","@type":"ListItem","url":"/walmart-st-louis-missouri-latest-remove-self-checkout-2024-4","position":39},{"@context":"httpschema.org","@type":"ListItem","url":"/bait-switch-job-interviews-unqualified-applicants-paying-remote-work-2022-9","position":40},{"@context":"httpschema.org","@type":"ListItem","url":"/trelers-slam-airbnb-chore-lists-mow-lawn-laundry-cleaning-fees-2022-9","position":41},{"@context":"httpschema.org","@type":"ListItem","url":"/layoffs-employees-most-at-risk-tech-jobs-recession-2022-8","position":42},{"@context":"httpschema.org","@type":"ListItem","url":"/china-xi-jiinping-future-tech-global-economy-semiconductors-military-failing-2022-9","position":43},{"@context":"httpschema.org","@type":"ListItem","url":"/soaring-home-prices-remote-work-from-home-retirees-moving-florida-2022-9","position":44},{"@context":"httpschema.org","@type"Ásia - Insider:"ListItem","url":"/ai-recycling-startups-aluminum-plastic-valuable-materials-2024-4","position":45},{"@context":"httpschema.org","@type":"ListItem","url":"/ai-dating-tinder-hinge-replika-rizz-date-love-romance-chatbot-2024-4","position":46},{"@context":"httpschema.org","@type":"ListItem","url":"/filmmaker-paul-trillo-pros-cons-test-openai-sora-hollywood-2024-4","position":47},{"@context":"httpschema.org","@type":"ListItem","url":"/personal-finance/who-has-the-best-cd-rates-right-now","position":48},{"@context":"httpschema.org","@type":"ListItem","url":"/bitcoin-halving-price-slump-rally-miners-hashrate-jpmorgan-crypto-btc-2024-4","position":49},{"@context":"httpschema.org","@type":"ListItem","url":"/jamie-dimon-bitcoin-crypto-ponzi-scheme-fraud-currency-blockchain-jpmorgan-2024-4","position":50}],"numberOfItems":50},"publisher":{"@context":"httpschema.org","@type":"Organization","name":"Insider","legalName":"InsiderInc.","foundingDate":"2007","url":"","sameAs":["/insiderbusiness","/businessinsider","/businessinsider","/company/businessinsider","/@InsiderBusiness"],"founder":{"@type":"Person","name":"HenryBlodget"},"logo":{"@type":"ImeObject","url":"/public/assets/logos/structured-data.png","width":305,"height":60}}}{"@context":"schema.org/","@type":"WebSite","url":"","name":"BusinessInsider","description":"BusinessInsidertellstheglobaltech,finance,markets,media,healthcare,andstrategystoriesyouwanttoknow.","potentialAction":{"@type":"SearchAction","target":"/s?q={search_term_string}","query-input":"requiredname=search_term_string"}}MenuiconAverticalstackofthreeevenlyspacedhorizontallines.SearchiconAmnifyingglass.Itindicates,"Clicktoperformasearch".BusinessInsiderlogoBusinessInsiderlogoBusinessInsiderlogoNewslettersSubscribeAccounticonAniconintheshapeofaperson'sheadandshoulders.Itoftenindicatesauserprofile.LoginSubscribeBusinessStrategyEconomyFinanceRetailAdvertisingCareersMediaRealEstateSmallBusinessTechScienceAISustainabilityEnterpriseTransportationStartupsInnovationMarketsStocksIndicesCommoditiesCryptoCurrenciesETFsLifestyleEntertainmentCultureTrelFoodHealthParentingReviewsCouponsPoliticsMilitary&DefenseLawEducationPersonalFinanceBankingCreditCardsInvestingLoansMortgesVideoBigBusinessFoodWarsSoExpensiveExplainersNewsStillStandingBootCampBusinessStrategyEconomyFinanceRetailAdvertisingCareersMediaRealEstateSmallBusinessTechScienceAISustainabilityEnterpriseTransportationStartupsInnovationMarketsStocksIndicesCommoditiesCryptoCurrenciesETFsLifestyleEntertainmentCultureTrelFoodHealthParentingReviewsTechStreamingHomeKitchenStyleBeautyPetsGiftsDealsCouponsAboutBICouponsToday'sBestSamsungGoogleWorkspacePoliticsMilitary&DefenseLawEducationPersonalFinanceBankingCreditCardsInvestingLoansMortgesVideoBigBusinessFoodWarsSoExpensiveExplainersNewsStillStandingBootCampAllA-ZAdvertisingAIBankingBusinessCareersCommoditiesCouponsCreditCardsCryptoCultureCurrenciesEconomyEducationEnterpriseEntertainmentETFsFinanceFoodHealthIndicesInnovationInvestingLawLifestyleLoansMarketsMediaMilitary&DefenseMortgesParentingPersonalFinancePoliticsRetailReviewsSmallBusinessScienceStartupsStocksStrategySustainabilityTechTransportationTrelVideoFeaturedTalentInsiderAboutAboutAdvertiseCareersCodeofEthicsContactUsCorporateCorrectionsPolicyFollowRSSSitemapFacebookTwitterInstramYouTubeLinkedInSubscriptionsIntelligencePremiumCloseiconTwocrossedlinesthatforman'X'.Itindicatesawaytocloseaninteraction,ordismissanotification.USMarketsLoading...hmsDAasksforsanctionsafterTrumpx27;sx27;disturbingx27;attackonprospectivejurorsTrumphasattackedprospectivejurorsonhisTruthSocialaccount,whichprosecutorssaywarrantsanctions.ElonMuskapologizedforx27;incorrectlylowx27;TeslaseverancepackesThenewfirstruleofhomebuying:fireyourrealtorTheworldx27;srichestpersonjustput2moreofhiskidsonhiscompanyx27;sboardHomepricesaresoaringinthese27cities,leingbuyersoutofluckMoreandmoreAmericansarebecomingx27;ALICEsx27;TrumptrialjurordismissedaftersheworriedaboutrevealedidentityWenowknowmoreaboutwhereTeslaisslashingjobsTeslalaidoff280workersatitsfacilityinBuffalo,NewYork,accordingtoaregulatoryfilinginNewYork.OliviaMunnsaysshex27;absolutelybrokedownx27;whenshesawherbodyafteradoublemastectomy"Ijustthought,x27;Oh,mygosh,thisiswhatIlooklike,andIdonx27;twanttolookatmyselfrightnow,x27;"MunntoldPeople.WallStreetissouringonTeslax27;spivotawayfromlow-costvehiclestowardsautonomousdriving"WeviewTeslax27;sshiftasthesis-changing,andworrythestockwillneedtoundergoapotentiallypainfultransitioninownershipbase."VideoNewEpisodesThisWeekHarryandMeghanareterribleatbusiness.Sowhydocompanieskeepofferingthemmillions?Electricgridsneedupgradesthankstodatacenters.Guesswhohelpspayforthat.Microsofthasatargettoamass1.8millionAIchipsbytheendoftheyear,internaldocumentshowsYou'reallset,enjoyyourBusinessInsideraccess!GotonewsletterpreferencesThanksforsigningup!Wetakeyouinsidethecompaniesandthetopicsthatmattertoyou.DownloadtheappNEWLOOKSignuptogettheinsidescoopontoday’sbiggeststoriesinmarkets,tech,andbusiness—delivereddaily.ReadpreviewEmailSignupByclicking“SignUp”,youacceptourTermsofServiceandPrivacyPolicy.Youcanopt-outatanytime.HarryandMeghanareterribleatbusiness.Sowhydocompanieskeepofferingthemmillions?Electricgridsneedupgradesthankstodatacenters.Guesswhohelpspayforthat.Microsofthasatargettoamass1.8millionAIchipsbytheendoftheyear,internaldocumentshowsMostpopularColoncancerratesarerisinginyoungpeople.Ifyouhetwosymptomsyoushouldgetacolonoscopy,aGIoncologistsays.Ix27;machefwhoshopsatTraderJoex27;s.Hereare15thingsIpickupeveryweekformyfamilyof3.Iworkasaprivatechefwhileraisingatoddler,andIshopatTraderJoex27;severyweekforeasy,affordablegroceriesthatgetfoodonthetable.RoyalCaribbeanx27;snewestshipisalsoitspriciest.Herex27;swhatitx27;slikespendingaslittleaspossible.ManyoftheenticingamenitiesonRoyalCaribbeanx27;snewworldx27;slargestcruiseship—fromthethrillridetothefunrestaurants—areup-charged.Ix27;vevisitedover50Europeancities.Herearethe5Icanx27;twaittoreturnto.Ix27;vevisitedover50citiesinEurope.AfewofmyforiteplacestovisitincludeBarcelona,Spain,Porto,Portugal,andEdinburg,Scotland.4HermèsBirkincollectorscrackedthecodetogettingtheirhandsonthecovetedbBirkinandKellyhandbsaremorethanjustpursestoHermèscollectors.Theyx27;realsoinvestmentpiecesandpracticalaccessoriestheyuseregularly.FedofficialscastmoredoubtonthetimingofratecutsthisyearThebestoffersfromBusinessInsiderCouponsStartyournewprojecttodaywiththebestHomeDepotcouponcodes.ShopexclusivesingseveryweekatStaples.com.PutyourbestfootforwardwithourbestDSWoffers.SpoilyourpetswithdealsjustforthematChewy.AdvertisementAdvertisementTechAdvertisementAdvertisementMarketsAdvertisementAdvertisementDiscourseAdvertisementAdvertisementVideoNewEpisodesThisWeekAdvertisementThebestoffersfromBusinessInsiderCouponsStartyournewprojecttodaywiththebestHomeDepotcouponcodes.ShopexclusivesingseveryweekatStaples.com.PutyourbestfootforwardwithourbestDSWoffers.SpoilyourpetswithdealsjustforthematChewy.AdvertisementAdvertisementAdvertisementCloseiconTwocrossedlinesthatforman'X'.Itindicatesawaytocloseaninteraction,ordismissanotification.Followuson:*©2024InsiderInc.Allrightsreserved.RegistrationonoruseofthissiteconstitutesacceptanceofourTermsofServiceandPrivacyPolicy.ContactUsMastheadSitemapDisclaimerAccessibilityCommercePolicyAdvertisingPoliciesCouponsJobs@BusinessInsiderStockquotesbyfinanzen.netReprints&PermissionsYourPrivacyChoicesInternationalEditions:UnitedStatesUSInternationalINTLDeutschland&ÖsterreichATDeutschlandDEEspañaESIndiaINJapanJPMéxicoMXNetherlandsNLPolskaPLJumptoMaincontentSearchAccount

Local:Ásia - InsiderRelatório

Se houver uma violação do site, clique em DenunciarRelatório

Informação recomendada

Site recomendado